Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   MHI44_RS02950 Genome accession   NZ_CP150268
Coordinates   554122..554505 (-) Length   127 a.a.
NCBI ID   WP_029317913.1    Uniprot ID   -
Organism   Bacillus sp. FSL K6-1366     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 549122..559505
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MHI44_RS02910 (MHI44_02910) sinI 550055..550228 (+) 174 WP_003230187.1 anti-repressor SinI family protein Regulator
  MHI44_RS02915 (MHI44_02915) sinR 550262..550597 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  MHI44_RS02920 (MHI44_02920) tasA 550690..551475 (-) 786 WP_015251717.1 biofilm matrix protein TasA -
  MHI44_RS02925 (MHI44_02925) - 551539..552111 (-) 573 WP_003230181.1 signal peptidase I -
  MHI44_RS02930 (MHI44_02930) tapA 552095..552856 (-) 762 WP_029726724.1 amyloid fiber anchoring/assembly protein TapA -
  MHI44_RS02935 (MHI44_02935) - 553128..553454 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  MHI44_RS02940 (MHI44_02940) - 553496..553675 (-) 180 WP_014480252.1 YqzE family protein -
  MHI44_RS02945 (MHI44_02945) comGG 553747..554121 (-) 375 WP_029726722.1 ComG operon protein ComGG Machinery gene
  MHI44_RS02950 (MHI44_02950) comGF 554122..554505 (-) 384 WP_029317913.1 ComG operon protein ComGF Machinery gene
  MHI44_RS02955 (MHI44_02955) comGE 554531..554878 (-) 348 WP_014480255.1 ComG operon protein 5 Machinery gene
  MHI44_RS02960 (MHI44_02960) comGD 554862..555293 (-) 432 WP_014480256.1 comG operon protein ComGD Machinery gene
  MHI44_RS02965 (MHI44_02965) comGC 555283..555579 (-) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  MHI44_RS02970 (MHI44_02970) comGB 555593..556630 (-) 1038 WP_029317912.1 comG operon protein ComGB Machinery gene
  MHI44_RS02975 (MHI44_02975) comGA 556617..557687 (-) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  MHI44_RS02980 (MHI44_02980) - 557899..558096 (-) 198 WP_014480259.1 CBS domain-containing protein -
  MHI44_RS02985 (MHI44_02985) corA 558098..559051 (-) 954 WP_015483432.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14363.43 Da        Isoelectric Point: 5.8949

>NTDB_id=968789 MHI44_RS02950 WP_029317913.1 554122..554505(-) (comGF) [Bacillus sp. FSL K6-1366]
MLISGSLAAIFHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLICTNLSGQDIRFEIYHSMIRKRVDG
KGHVPILDHITAMKADFENGVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=968789 MHI44_RS02950 WP_029317913.1 554122..554505(-) (comGF) [Bacillus sp. FSL K6-1366]
TTGCTCATATCAGGATCGTTAGCTGCGATTTTCCATCTGTTTTTGTCTCGACAGCAGGAACATGACGGTTTCACACAGCA
AGAATGGATGATTTCGATAGAACAGATGATGAATGAATGCAAGGAGTCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGGCAGGACATCCGTTTCGAAATTTATCATTCAATGATAAGAAAAAGAGTGGATGGT
AAAGGGCATGTTCCGATTTTAGATCATATTACTGCCATGAAAGCTGATTTTGAAAATGGTGTTGTTTTGCTGAAAATTGA
GAGTGAGGACCAAAAAGTGTATCAAACTGCTTTTCCAGTCTATTCGTATTTAGGAGGGGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

97.638

100

0.976


Multiple sequence alignment