Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   MHI44_RS02910 Genome accession   NZ_CP150268
Coordinates   550055..550228 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus sp. FSL K6-1366     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 545055..555228
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MHI44_RS02895 (MHI44_02895) gcvT 545854..546942 (-) 1089 WP_339202833.1 glycine cleavage system aminomethyltransferase GcvT -
  MHI44_RS02900 (MHI44_02900) - 547384..549057 (+) 1674 WP_029726726.1 SNF2-related protein -
  MHI44_RS02905 (MHI44_02905) - 549078..549872 (+) 795 WP_003230200.1 YqhG family protein -
  MHI44_RS02910 (MHI44_02910) sinI 550055..550228 (+) 174 WP_003230187.1 anti-repressor SinI family protein Regulator
  MHI44_RS02915 (MHI44_02915) sinR 550262..550597 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  MHI44_RS02920 (MHI44_02920) tasA 550690..551475 (-) 786 WP_015251717.1 biofilm matrix protein TasA -
  MHI44_RS02925 (MHI44_02925) - 551539..552111 (-) 573 WP_003230181.1 signal peptidase I -
  MHI44_RS02930 (MHI44_02930) tapA 552095..552856 (-) 762 WP_029726724.1 amyloid fiber anchoring/assembly protein TapA -
  MHI44_RS02935 (MHI44_02935) - 553128..553454 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  MHI44_RS02940 (MHI44_02940) - 553496..553675 (-) 180 WP_014480252.1 YqzE family protein -
  MHI44_RS02945 (MHI44_02945) comGG 553747..554121 (-) 375 WP_029726722.1 ComG operon protein ComGG Machinery gene
  MHI44_RS02950 (MHI44_02950) comGF 554122..554505 (-) 384 WP_029317913.1 ComG operon protein ComGF Machinery gene
  MHI44_RS02955 (MHI44_02955) comGE 554531..554878 (-) 348 WP_014480255.1 ComG operon protein 5 Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=968786 MHI44_RS02910 WP_003230187.1 550055..550228(+) (sinI) [Bacillus sp. FSL K6-1366]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=968786 MHI44_RS02910 WP_003230187.1 550055..550228(+) (sinI) [Bacillus sp. FSL K6-1366]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterproScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment