Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssbA   Type   Machinery gene
Locus tag   NST10_RS13700 Genome accession   NZ_CP150198
Coordinates   2789949..2790419 (+) Length   156 a.a.
NCBI ID   WP_047214707.1    Uniprot ID   -
Organism   Staphylococcus sp. FSL W8-0305     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 2753098..2796375 2789949..2790419 within 0


Gene organization within MGE regions


Location: 2753098..2796375
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NST10_RS13440 (NST10_13440) groES 2753098..2753382 (+) 285 WP_000917289.1 co-chaperone GroES -
  NST10_RS13445 (NST10_13445) groL 2753458..2755074 (+) 1617 WP_000240651.1 chaperonin GroEL -
  NST10_RS13450 (NST10_13450) - 2755143..2756315 (-) 1173 WP_000179348.1 tyrosine-type recombinase/integrase -
  NST10_RS13455 (NST10_13455) - 2756316..2757086 (-) 771 WP_000589126.1 helix-turn-helix domain-containing protein -
  NST10_RS13460 (NST10_13460) - 2757258..2757476 (+) 219 WP_000989513.1 helix-turn-helix transcriptional regulator -
  NST10_RS13465 (NST10_13465) - 2757480..2757797 (+) 318 WP_000481969.1 helix-turn-helix domain-containing protein -
  NST10_RS13470 (NST10_13470) - 2757794..2757940 (+) 147 WP_000784885.1 hypothetical protein -
  NST10_RS13475 (NST10_13475) - 2757933..2758145 (+) 213 WP_001058497.1 hypothetical protein -
  NST10_RS13480 (NST10_13480) - 2758147..2758506 (+) 360 WP_136624639.1 pathogenicity island protein -
  NST10_RS13485 (NST10_13485) - 2758507..2758821 (+) 315 WP_063650259.1 DUF1474 family protein -
  NST10_RS13490 (NST10_13490) - 2758892..2761144 (+) 2253 WP_339210384.1 phage/plasmid primase, P4 family -
  NST10_RS13495 (NST10_13495) - 2761415..2761759 (+) 345 WP_000567972.1 hypothetical protein -
  NST10_RS13500 (NST10_13500) - 2761761..2762402 (+) 642 WP_136624638.1 pathogenicity island protein -
  NST10_RS13505 (NST10_13505) - 2762938..2763279 (+) 342 WP_023604825.1 hypothetical protein -
  NST10_RS13510 (NST10_13510) - 2763291..2763869 (+) 579 WP_000846277.1 hypothetical protein -
  NST10_RS13515 (NST10_13515) - 2763887..2764105 (+) 219 WP_000448775.1 capsid morphogenesis B protein -
  NST10_RS13520 (NST10_13520) - 2764156..2764683 (+) 528 WP_023604826.1 spore coat protein -
  NST10_RS13525 (NST10_13525) - 2764815..2765027 (+) 213 WP_025174984.1 hypothetical protein -
  NST10_RS13530 (NST10_13530) - 2765024..2765593 (+) 570 WP_339210388.1 terminase small subunit -
  NST10_RS13535 (NST10_13535) - 2766022..2766540 (+) 519 WP_000624990.1 hypothetical protein -
  NST10_RS13540 (NST10_13540) - 2766537..2766965 (+) 429 WP_000591858.1 hypothetical protein -
  NST10_RS13545 (NST10_13545) - 2766952..2767731 (+) 780 WP_000705255.1 hypothetical protein -
  NST10_RS13550 (NST10_13550) - 2767968..2768195 (+) 228 WP_061642086.1 hypothetical protein -
  NST10_RS13555 (NST10_13555) - 2768267..2768365 (+) 99 Protein_2629 hypothetical protein -
  NST10_RS13560 (NST10_13560) - 2768669..2768944 (+) 276 Protein_2630 hypothetical protein -
  NST10_RS13565 (NST10_13565) - 2769050..2769985 (-) 936 WP_061642085.1 TDT family transporter -
  NST10_RS13570 (NST10_13570) - 2771105..2771284 (+) 180 WP_000201397.1 hypothetical protein -
  NST10_RS13575 (NST10_13575) - 2771281..2771577 (+) 297 WP_001573769.1 hypothetical protein -
  NST10_RS13580 (NST10_13580) - 2771567..2771908 (+) 342 WP_001573771.1 hypothetical protein -
  NST10_RS13585 (NST10_13585) - 2772486..2773793 (-) 1308 WP_001045073.1 TrkH family potassium uptake protein -
  NST10_RS13590 (NST10_13590) - 2774232..2775454 (-) 1223 Protein_2636 ArgE/DapE family deacylase -
  NST10_RS13595 (NST10_13595) - 2775886..2776941 (+) 1056 WP_000791398.1 leukocidin family pore-forming toxin -
  NST10_RS13600 (NST10_13600) - 2776963..2777982 (+) 1020 WP_000595617.1 leukocidin/hemolysin toxin family protein -
  NST10_RS13605 (NST10_13605) sph 2778239..2779069 (-) 831 Protein_2639 sphingomyelin phosphodiesterase -
  NST10_RS13610 (NST10_13610) - 2779120..2780157 (-) 1038 WP_061651379.1 site-specific integrase -
  NST10_RS13615 (NST10_13615) - 2780348..2781061 (-) 714 WP_001549185.1 type II toxin-antitoxin system PemK/MazF family toxin -
  NST10_RS13620 (NST10_13620) - 2781140..2781322 (-) 183 WP_000705243.1 hypothetical protein -
  NST10_RS13625 (NST10_13625) - 2781478..2782176 (-) 699 WP_000837517.1 potassium channel family protein -
  NST10_RS13630 (NST10_13630) - 2782358..2782990 (-) 633 WP_031763806.1 XRE family transcriptional regulator -
  NST10_RS13635 (NST10_13635) - 2783144..2783371 (+) 228 WP_000192116.1 helix-turn-helix transcriptional regulator -
  NST10_RS13640 (NST10_13640) - 2783394..2784182 (+) 789 WP_031763800.1 phage antirepressor KilAC domain-containing protein -
  NST10_RS13645 (NST10_13645) - 2784199..2784393 (+) 195 WP_001566738.1 hypothetical protein -
  NST10_RS13650 (NST10_13650) - 2784388..2784744 (-) 357 WP_000768245.1 DUF2513 domain-containing protein -
  NST10_RS13655 (NST10_13655) - 2784794..2784985 (+) 192 WP_000389905.1 hypothetical protein -
  NST10_RS13660 (NST10_13660) - 2784987..2785214 (-) 228 WP_000801108.1 hypothetical protein -
  NST10_RS13665 (NST10_13665) - 2785273..2785593 (+) 321 WP_001120935.1 DUF771 domain-containing protein -
  NST10_RS13670 (NST10_13670) - 2785590..2785751 (+) 162 WP_000066020.1 DUF1270 domain-containing protein -
  NST10_RS13675 (NST10_13675) - 2785844..2786104 (+) 261 WP_000291488.1 DUF1108 family protein -
  NST10_RS13680 (NST10_13680) - 2786113..2786376 (+) 264 WP_001205732.1 hypothetical protein -
  NST10_RS13685 (NST10_13685) - 2786373..2788328 (+) 1956 WP_047214705.1 AAA family ATPase -
  NST10_RS13690 (NST10_13690) - 2788330..2789250 (+) 921 WP_000138473.1 recombinase RecT -
  NST10_RS13695 (NST10_13695) - 2789331..2789948 (+) 618 WP_225969699.1 MBL fold metallo-hydrolase -
  NST10_RS13700 (NST10_13700) ssbA 2789949..2790419 (+) 471 WP_047214707.1 single-stranded DNA-binding protein Machinery gene
  NST10_RS13705 (NST10_13705) - 2790449..2791333 (+) 885 WP_339210402.1 DnaD domain protein -
  NST10_RS13710 (NST10_13710) - 2791340..2791558 (+) 219 WP_000338528.1 hypothetical protein -
  NST10_RS13715 (NST10_13715) - 2791567..2791971 (+) 405 WP_001662398.1 RusA family crossover junction endodeoxyribonuclease -
  NST10_RS13720 (NST10_13720) - 2791984..2792355 (+) 372 WP_064271353.1 SA1788 family PVL leukocidin-associated protein -
  NST10_RS13725 (NST10_13725) - 2792356..2792604 (+) 249 WP_031793512.1 phi PVL orf 51-like protein -
  NST10_RS13730 (NST10_13730) - 2792645..2792896 (+) 252 WP_001065074.1 DUF1024 family protein -
  NST10_RS13735 (NST10_13735) - 2792886..2793068 (+) 183 WP_000028425.1 hypothetical protein -
  NST10_RS13740 (NST10_13740) - 2793061..2793597 (+) 537 WP_000185703.1 dUTPase -
  NST10_RS13745 (NST10_13745) - 2793634..2793879 (+) 246 WP_001282074.1 hypothetical protein -
  NST10_RS13750 (NST10_13750) - 2793876..2794064 (+) 189 WP_000195782.1 DUF1381 domain-containing protein -
  NST10_RS13755 (NST10_13755) - 2794039..2794239 (+) 201 WP_001125015.1 hypothetical protein -
  NST10_RS13760 (NST10_13760) - 2794242..2794391 (+) 150 WP_339210412.1 transcriptional regulator -
  NST10_RS13765 (NST10_13765) - 2794550..2795200 (+) 651 WP_001005262.1 hypothetical protein -
  NST10_RS13770 (NST10_13770) - 2795200..2795400 (+) 201 WP_000265041.1 DUF1514 family protein -
  NST10_RS13775 (NST10_13775) - 2795428..2795844 (+) 417 WP_064271351.1 transcriptional regulator -
  NST10_RS13780 (NST10_13780) - 2796076..2796375 (+) 300 WP_000988330.1 HNH endonuclease -

Sequence


Protein


Download         Length: 156 a.a.        Molecular weight: 17579.36 Da        Isoelectric Point: 4.9327

>NTDB_id=966047 NST10_RS13700 WP_047214707.1 2789949..2790419(+) (ssbA) [Staphylococcus sp. FSL W8-0305]
MLNRVVLVGRLTKDPEYRTTPSGVSVATFTLAVNRTFTNAQGEREADFINCVVFRRQADNVNNYLSKGSLAGVDGRLQSR
NYENQEGRRVFVAEVVCDSVQFLEPKNTNDSQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIELNDDDLPF

Nucleotide


Download         Length: 471 bp        

>NTDB_id=966047 NST10_RS13700 WP_047214707.1 2789949..2790419(+) (ssbA) [Staphylococcus sp. FSL W8-0305]
ATGCTAAATAGAGTTGTATTAGTAGGTCGTTTAACGAAAGATCCGGAATACAGAACCACTCCCTCAGGTGTGAGTGTAGC
GACATTCACTCTTGCAGTAAATCGTACGTTCACGAATGCTCAAGGGGAGCGCGAAGCAGATTTTATTAACTGTGTTGTTT
TTAGAAGACAAGCAGATAATGTAAATAACTATTTATCTAAAGGTAGTTTAGCTGGTGTAGATGGTCGCTTACAATCCCGT
AATTATGAAAATCAAGAAGGTCGTCGTGTGTTTGTTGCTGAAGTTGTGTGTGATAGCGTTCAATTTTTAGAACCAAAGAA
CACAAATGACTCTCAACAAGATTTATATCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAACTAAATGATGATGATTTACCATTCTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssbA Bacillus subtilis subsp. subtilis str. 168

60.452

100

0.686

  ssb Latilactobacillus sakei subsp. sakei 23K

51.765

100

0.564

  ssbB Bacillus subtilis subsp. subtilis str. 168

57.547

67.949

0.391

  ssb Glaesserella parasuis strain SC1401

32.203

100

0.365


Multiple sequence alignment