Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   NSU16_RS15595 Genome accession   NZ_CP150176
Coordinates   3039319..3039459 (-) Length   46 a.a.
NCBI ID   WP_010331694.1    Uniprot ID   A0AAP3CUJ5
Organism   Bacillus sp. FSL K6-1003     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3034319..3044459
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NSU16_RS15570 (NSU16_15570) - 3034633..3035013 (-) 381 WP_229149090.1 hotdog fold thioesterase -
  NSU16_RS15575 (NSU16_15575) comA 3035031..3035675 (-) 645 WP_010331690.1 two-component system response regulator ComA Regulator
  NSU16_RS15580 (NSU16_15580) comP 3035756..3038065 (-) 2310 WP_339192701.1 two-component system sensor histidine kinase ComP Regulator
  NSU16_RS15585 (NSU16_15585) comX 3038081..3038248 (-) 168 WP_044158946.1 competence pheromone ComX Regulator
  NSU16_RS15590 (NSU16_15590) comQ 3038232..3039134 (-) 903 WP_168749496.1 polyprenyl synthetase family protein Regulator
  NSU16_RS15595 (NSU16_15595) degQ 3039319..3039459 (-) 141 WP_010331694.1 degradation enzyme regulation protein DegQ Regulator
  NSU16_RS15600 (NSU16_15600) - 3039920..3040288 (+) 369 WP_268447270.1 hypothetical protein -
  NSU16_RS15605 (NSU16_15605) - 3040264..3041493 (-) 1230 WP_010331696.1 EAL and HDOD domain-containing protein -
  NSU16_RS15610 (NSU16_15610) - 3041629..3043098 (-) 1470 WP_010331697.1 nicotinate phosphoribosyltransferase -
  NSU16_RS15615 (NSU16_15615) - 3043114..3043665 (-) 552 WP_044158950.1 isochorismatase family cysteine hydrolase -
  NSU16_RS15620 (NSU16_15620) - 3043762..3044160 (-) 399 WP_339191430.1 DUF1694 domain-containing protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5517.44 Da        Isoelectric Point: 6.2565

>NTDB_id=965029 NSU16_RS15595 WP_010331694.1 3039319..3039459(-) (degQ) [Bacillus sp. FSL K6-1003]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKFTYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=965029 NSU16_RS15595 WP_010331694.1 3039319..3039459(-) (degQ) [Bacillus sp. FSL K6-1003]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCACATACGCAATGAAAATTTCGTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

95.652

100

0.957

Multiple sequence alignment