Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssbA   Type   Machinery gene
Locus tag   NSQ16_RS21525 Genome accession   NZ_CP150155
Coordinates   4128968..4129486 (-) Length   172 a.a.
NCBI ID   WP_003219228.1    Uniprot ID   A0A063XE16
Organism   Bacillus sp. PS108     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 4081050..4128953 4128968..4129486 flank 15


Gene organization within MGE regions


Location: 4081050..4129486
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NSQ16_RS21220 (NSQ16_21220) - 4081465..4082775 (+) 1311 WP_014478548.1 MFS transporter -
  NSQ16_RS21225 (NSQ16_21225) - 4082936..4083673 (+) 738 WP_032676932.1 MerR family transcriptional regulator -
  NSQ16_RS21230 (NSQ16_21230) - 4083711..4084499 (-) 789 WP_032676931.1 hypothetical protein -
  NSQ16_RS21235 (NSQ16_21235) - 4084567..4084956 (-) 390 WP_029726106.1 nuclear transport factor 2 family protein -
  NSQ16_RS21240 (NSQ16_21240) - 4085102..4085941 (+) 840 WP_003226887.1 pentapeptide repeat-containing protein -
  NSQ16_RS21245 (NSQ16_21245) - 4085974..4087188 (-) 1215 WP_003226885.1 MFS transporter -
  NSQ16_RS21250 (NSQ16_21250) - 4087376..4088254 (+) 879 WP_003226883.1 LysR family transcriptional regulator -
  NSQ16_RS21255 (NSQ16_21255) - 4088268..4088711 (+) 444 WP_003226881.1 GNAT family N-acetyltransferase -
  NSQ16_RS21260 (NSQ16_21260) - 4088794..4089273 (+) 480 WP_003226879.1 hypothetical protein -
  NSQ16_RS21265 (NSQ16_21265) - 4089298..4089431 (-) 134 Protein_4131 LysR family transcriptional regulator -
  NSQ16_RS21270 (NSQ16_21270) - 4089448..4090110 (-) 663 WP_003226877.1 MBL fold metallo-hydrolase -
  NSQ16_RS21275 (NSQ16_21275) - 4090257..4090709 (-) 453 WP_003226875.1 MarR family transcriptional regulator -
  NSQ16_RS21280 (NSQ16_21280) - 4090829..4091275 (+) 447 WP_003226873.1 GNAT family N-acetyltransferase -
  NSQ16_RS21285 (NSQ16_21285) - 4091272..4091874 (+) 603 WP_003226872.1 YitT family protein -
  NSQ16_RS21290 (NSQ16_21290) satA 4091942..4092463 (-) 522 WP_085185293.1 streptothricin N-acetyltransferase SatA -
  NSQ16_RS21295 (NSQ16_21295) - 4092846..4093202 (+) 357 WP_029726097.1 MmcQ/YjbR family DNA-binding protein -
  NSQ16_RS21300 (NSQ16_21300) - 4093361..4093927 (+) 567 WP_085185291.1 dihydrofolate reductase family protein -
  NSQ16_RS21305 (NSQ16_21305) - 4094170..4094331 (+) 162 WP_085185289.1 DUF255 domain-containing protein -
  NSQ16_RS21310 (NSQ16_21310) tet(L) 4094434..4095810 (-) 1377 WP_085185287.1 tetracycline efflux MFS transporter Tet(L) -
  NSQ16_RS21315 (NSQ16_21315) - 4096160..4096399 (+) 240 WP_003243894.1 DUF255 domain-containing protein -
  NSQ16_RS21320 (NSQ16_21320) - 4096549..4096965 (+) 417 WP_010886646.1 MerR family transcriptional regulator -
  NSQ16_RS21325 (NSQ16_21325) - 4096962..4097879 (+) 918 WP_085185285.1 EamA family transporter -
  NSQ16_RS21330 (NSQ16_21330) - 4097951..4098121 (+) 171 Protein_4144 DUF255 domain-containing protein -
  NSQ16_RS21335 (NSQ16_21335) - 4098207..4099718 (+) 1512 WP_339232481.1 recombinase family protein -
  NSQ16_RS21340 (NSQ16_21340) - 4099751..4100119 (-) 369 WP_144486887.1 hypothetical protein -
  NSQ16_RS21345 (NSQ16_21345) - 4100349..4100729 (-) 381 WP_088679614.1 cystatin-like fold lipoprotein -
  NSQ16_RS21350 (NSQ16_21350) - 4100792..4101298 (-) 507 WP_088679578.1 hypothetical protein -
  NSQ16_RS21355 (NSQ16_21355) - 4101313..4102302 (-) 990 WP_339232484.1 bifunctional lytic transglycosylase/C40 family peptidase -
  NSQ16_RS21360 (NSQ16_21360) conG 4102299..4104746 (-) 2448 WP_339232487.1 transposon conjugation system subunit ConG -
  NSQ16_RS21365 (NSQ16_21365) - 4104750..4105076 (-) 327 WP_033881975.1 YddF family protein -
  NSQ16_RS21370 (NSQ16_21370) conE 4105094..4107589 (-) 2496 WP_339232489.1 VirB4-like ATPase ConE -
  NSQ16_RS21375 (NSQ16_21375) - 4107477..4108001 (-) 525 WP_041516320.1 conjugal transfer protein -
  NSQ16_RS21380 (NSQ16_21380) conC 4108014..4108262 (-) 249 WP_339232491.1 transposon conjugation system subunit ConC -
  NSQ16_RS21385 (NSQ16_21385) - 4108274..4109338 (-) 1065 WP_339232492.1 conjugal transfer protein -
  NSQ16_RS21390 (NSQ16_21390) - 4109366..4109515 (-) 150 WP_003328171.1 hypothetical protein -
  NSQ16_RS21395 (NSQ16_21395) - 4109533..4109811 (-) 279 WP_080624166.1 hypothetical protein -
  NSQ16_RS21400 (NSQ16_21400) - 4109824..4110141 (-) 318 WP_339232494.1 hypothetical protein -
  NSQ16_RS21405 (NSQ16_21405) - 4110153..4110419 (-) 267 WP_339232496.1 hypothetical protein -
  NSQ16_RS21410 (NSQ16_21410) nicK 4110686..4111744 (-) 1059 WP_339232497.1 DNA relaxase NicK -
  NSQ16_RS21415 (NSQ16_21415) - 4111737..4113179 (-) 1443 WP_339232750.1 ATP-binding protein -
  NSQ16_RS21420 (NSQ16_21420) - 4113429..4113803 (-) 375 WP_032730573.1 YdcP family protein -
  NSQ16_RS21425 (NSQ16_21425) - 4113850..4113966 (-) 117 WP_339232499.1 hypothetical protein -
  NSQ16_RS21430 (NSQ16_21430) - 4114172..4114432 (-) 261 WP_217828095.1 hypothetical protein -
  NSQ16_RS21435 (NSQ16_21435) - 4114486..4114746 (-) 261 WP_339232502.1 hypothetical protein -
  NSQ16_RS21440 (NSQ16_21440) - 4114743..4114922 (-) 180 WP_017418449.1 hypothetical protein -
  NSQ16_RS21445 (NSQ16_21445) - 4115217..4115600 (+) 384 WP_305935182.1 helix-turn-helix transcriptional regulator -
  NSQ16_RS21450 (NSQ16_21450) - 4115597..4116127 (+) 531 WP_019716392.1 ImmA/IrrE family metallo-endopeptidase -
  NSQ16_RS21455 (NSQ16_21455) - 4116239..4117435 (-) 1197 WP_339232507.1 Rap family tetratricopeptide repeat protein -
  NSQ16_RS21460 (NSQ16_21460) - 4117663..4118382 (-) 720 WP_305935184.1 hypothetical protein -
  NSQ16_RS21465 (NSQ16_21465) - 4118604..4118681 (+) 78 Protein_4171 DUF255 domain-containing protein -
  NSQ16_RS21470 (NSQ16_21470) - 4118912..4119637 (+) 726 WP_326256215.1 PmeII family type II restriction endonuclease -
  NSQ16_RS21475 (NSQ16_21475) - 4119701..4121041 (-) 1341 WP_231592845.1 DNA (cytosine-5-)-methyltransferase -
  NSQ16_RS21480 (NSQ16_21480) - 4121261..4121422 (+) 162 WP_080316903.1 DUF255 domain-containing protein -
  NSQ16_RS21485 (NSQ16_21485) - 4121461..4123350 (+) 1890 WP_327836161.1 thioredoxin domain-containing protein -
  NSQ16_RS21490 (NSQ16_21490) - 4123347..4124246 (-) 900 WP_015250787.1 type II CAAX endopeptidase family protein -
  NSQ16_RS21495 (NSQ16_21495) - 4124472..4125827 (+) 1356 WP_048654832.1 MFS transporter -
  NSQ16_RS21500 (NSQ16_21500) - 4125861..4126415 (-) 555 WP_032722825.1 sugar O-acetyltransferase -
  NSQ16_RS21505 (NSQ16_21505) - 4126433..4126813 (-) 381 WP_048654831.1 VOC family protein -
  NSQ16_RS21510 (NSQ16_21510) ccpB 4126869..4127804 (-) 936 WP_048654830.1 transcriptional regulator CcpB -
  NSQ16_RS21515 (NSQ16_21515) xth 4127863..4128621 (-) 759 WP_029726087.1 exodeoxyribonuclease III -
  NSQ16_RS21520 (NSQ16_21520) rpsR 4128685..4128924 (-) 240 WP_003219224.1 30S ribosomal protein S18 -
  NSQ16_RS21525 (NSQ16_21525) ssbA 4128968..4129486 (-) 519 WP_003219228.1 single-stranded DNA-binding protein SsbA Machinery gene

Sequence


Protein


Download         Length: 172 a.a.        Molecular weight: 18742.31 Da        Isoelectric Point: 4.7621

>NTDB_id=963700 NSQ16_RS21525 WP_003219228.1 4128968..4129486(-) (ssbA) [Bacillus sp. PS108]
MLNRVVLVGRLTKDPELRYTPNGAAVATFTLAVNRTFTNQSGEREADFINCVTWRRQAENVANFLKKGSLAGVDGRLQTR
NYENQQGQRVFVTEVQAESVQFLEPKNGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQRRNQGNSFNDDPFANDG
KPIDISDDDLPF

Nucleotide


Download         Length: 519 bp        

>NTDB_id=963700 NSQ16_RS21525 WP_003219228.1 4128968..4129486(-) (ssbA) [Bacillus sp. PS108]
ATGCTTAACCGAGTTGTATTAGTCGGAAGACTGACAAAAGACCCAGAGCTTCGTTATACGCCAAACGGTGCGGCTGTTGC
TACGTTTACTCTTGCTGTGAATCGTACATTTACGAACCAGTCCGGAGAACGTGAGGCCGATTTCATTAATTGTGTCACTT
GGAGAAGACAAGCCGAAAACGTTGCAAACTTCTTGAAAAAAGGAAGCCTTGCAGGCGTAGATGGCCGTTTACAAACAAGA
AACTATGAAAACCAGCAAGGACAGCGTGTCTTCGTGACAGAGGTCCAAGCTGAAAGTGTTCAATTTCTTGAGCCGAAAAA
CGGCGGCGGTTCTGGTTCAGGTGGATACAACGAAGGAAACAGCGGCGGAGGCCAGTACTTTGGCGGAGGCCAAAATGATA
ATCCATTTGGGGGAAATCAAAACAACCAGAGACGCAATCAGGGGAACAGCTTTAATGATGACCCATTTGCCAACGACGGC
AAACCGATTGACATCTCGGATGATGATCTTCCATTCTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A063XE16

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssbA Bacillus subtilis subsp. subtilis str. 168

100

100

1

  ssb Latilactobacillus sakei subsp. sakei 23K

58.192

100

0.599

  ssbB Bacillus subtilis subsp. subtilis str. 168

64.151

61.628

0.395

  ssb Glaesserella parasuis strain SC1401

35.519

100

0.378