Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | WJ060_RS10745 | Genome accession | NZ_CP149492 |
| Coordinates | 2145748..2146218 (-) | Length | 156 a.a. |
| NCBI ID | WP_000934759.1 | Uniprot ID | A0A2I7Y8V1 |
| Organism | Staphylococcus aureus strain BPH2947 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2114725..2175274 | 2145748..2146218 | within | 0 |
Gene organization within MGE regions
Location: 2114725..2175274
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| WJ060_RS10520 (WJ060_10500) | scn | 2114725..2115075 (-) | 351 | WP_000702262.1 | complement inhibitor SCIN-A | - |
| WJ060_RS10525 (WJ060_10505) | - | 2115585..2115923 (-) | 339 | Protein_2038 | SH3 domain-containing protein | - |
| WJ060_RS10530 (WJ060_10510) | sak | 2116572..2117063 (-) | 492 | WP_000920041.1 | staphylokinase | - |
| WJ060_RS10535 (WJ060_10515) | - | 2117254..2118009 (-) | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
| WJ060_RS10540 (WJ060_10520) | - | 2118021..2118275 (-) | 255 | WP_000611512.1 | phage holin | - |
| WJ060_RS10545 (WJ060_10525) | - | 2118327..2118434 (+) | 108 | Protein_2042 | hypothetical protein | - |
| WJ060_RS10550 (WJ060_10530) | pepG1 | 2118487..2118621 (-) | 135 | WP_000226106.1 | type I toxin-antitoxin system toxin PepG1 | - |
| WJ060_RS10555 (WJ060_10535) | sea | 2118772..2119545 (-) | 774 | WP_000750412.1 | staphylococcal enterotoxin type A | - |
| WJ060_RS10560 (WJ060_10540) | - | 2119918..2120292 (-) | 375 | WP_000340977.1 | hypothetical protein | - |
| WJ060_RS10565 (WJ060_10545) | - | 2120348..2120635 (-) | 288 | WP_001262621.1 | hypothetical protein | - |
| WJ060_RS10570 (WJ060_10550) | - | 2120681..2120833 (-) | 153 | WP_001000059.1 | hypothetical protein | - |
| WJ060_RS10575 (WJ060_10555) | - | 2120826..2124608 (-) | 3783 | WP_000582173.1 | phage tail spike protein | - |
| WJ060_RS10580 (WJ060_10560) | - | 2124624..2126108 (-) | 1485 | WP_000567408.1 | phage distal tail protein | - |
| WJ060_RS10585 (WJ060_10565) | - | 2126105..2130634 (-) | 4530 | WP_001795393.1 | phage tail tape measure protein | - |
| WJ060_RS10590 (WJ060_10570) | gpGT | 2130691..2130828 (-) | 138 | WP_001549167.1 | phage tail assembly chaperone GT | - |
| WJ060_RS10595 (WJ060_10575) | gpG | 2130879..2131229 (-) | 351 | WP_001096355.1 | phage tail assembly chaperone G | - |
| WJ060_RS10600 (WJ060_10580) | - | 2131279..2131503 (-) | 225 | WP_072050172.1 | Ig-like domain-containing protein | - |
| WJ060_RS10605 (WJ060_10585) | - | 2131545..2132189 (-) | 645 | WP_000268741.1 | major tail protein | - |
| WJ060_RS10610 (WJ060_10590) | - | 2132190..2132597 (-) | 408 | WP_000565498.1 | hypothetical protein | - |
| WJ060_RS10615 (WJ060_10595) | - | 2132594..2132998 (-) | 405 | WP_000114225.1 | HK97 gp10 family phage protein | - |
| WJ060_RS10620 (WJ060_10600) | - | 2132995..2133357 (-) | 363 | WP_000755150.1 | head-tail adaptor protein | - |
| WJ060_RS10625 (WJ060_10605) | - | 2133341..2133625 (-) | 285 | WP_000150936.1 | phage head-tail adapter protein | - |
| WJ060_RS10630 (WJ060_10610) | - | 2133615..2133898 (-) | 284 | Protein_2059 | hypothetical protein | - |
| WJ060_RS10635 (WJ060_10615) | - | 2133918..2135063 (-) | 1146 | WP_129760512.1 | phage major capsid protein | - |
| WJ060_RS10640 (WJ060_10620) | - | 2135087..2135824 (-) | 738 | WP_000861914.1 | head maturation protease, ClpP-related | - |
| WJ060_RS10645 (WJ060_10625) | - | 2135808..2136995 (-) | 1188 | WP_000025274.1 | phage portal protein | - |
| WJ060_RS10650 (WJ060_10630) | - | 2137011..2138672 (-) | 1662 | WP_000625088.1 | terminase large subunit | - |
| WJ060_RS10655 (WJ060_10635) | - | 2138669..2139013 (-) | 345 | WP_000402904.1 | hypothetical protein | - |
| WJ060_RS10660 (WJ060_10640) | - | 2139144..2139443 (-) | 300 | WP_000988336.1 | HNH endonuclease | - |
| WJ060_RS10665 (WJ060_10645) | - | 2139675..2140091 (-) | 417 | WP_000590126.1 | hypothetical protein | - |
| WJ060_RS10670 (WJ060_10650) | - | 2140119..2140319 (-) | 201 | WP_000265039.1 | DUF1514 family protein | - |
| WJ060_RS10675 (WJ060_10655) | rinB | 2140319..2140468 (-) | 150 | WP_000595265.1 | transcriptional activator RinB | - |
| WJ060_RS10680 (WJ060_10660) | - | 2140465..2140851 (-) | 387 | WP_000592207.1 | hypothetical protein | - |
| WJ060_RS10685 (WJ060_10665) | - | 2140848..2141054 (-) | 207 | WP_000195820.1 | DUF1381 domain-containing protein | - |
| WJ060_RS10690 (WJ060_10670) | - | 2141091..2141627 (-) | 537 | WP_001066444.1 | dUTPase | - |
| WJ060_RS10695 (WJ060_10675) | - | 2141620..2142030 (-) | 411 | WP_000197967.1 | hypothetical protein | - |
| WJ060_RS10700 (WJ060_10680) | - | 2142387..2142512 (-) | 126 | Protein_2073 | DUF1024 family protein | - |
| WJ060_RS10705 (WJ060_10685) | - | 2142505..2142789 (-) | 285 | WP_001105604.1 | hypothetical protein | - |
| WJ060_RS10710 (WJ060_10690) | - | 2142786..2143235 (-) | 450 | WP_000982711.1 | YopX family protein | - |
| WJ060_RS10715 (WJ060_10695) | - | 2143300..2143542 (-) | 243 | WP_000221871.1 | SAV1978 family virulence-associated passenger protein | - |
| WJ060_RS10720 (WJ060_10700) | - | 2143545..2143802 (-) | 258 | WP_000111491.1 | DUF3310 domain-containing protein | - |
| WJ060_RS10725 (WJ060_10705) | - | 2143802..2144174 (-) | 373 | Protein_2078 | SA1788 family PVL leukocidin-associated protein | - |
| WJ060_RS10730 (WJ060_10710) | - | 2144187..2144591 (-) | 405 | WP_000401969.1 | RusA family crossover junction endodeoxyribonuclease | - |
| WJ060_RS10735 (WJ060_10715) | - | 2144600..2144818 (-) | 219 | WP_000338528.1 | hypothetical protein | - |
| WJ060_RS10740 (WJ060_10720) | - | 2144825..2145718 (-) | 894 | WP_000148333.1 | DnaD domain-containing protein | - |
| WJ060_RS10745 (WJ060_10725) | ssbA | 2145748..2146218 (-) | 471 | WP_000934759.1 | single-stranded DNA-binding protein | Machinery gene |
| WJ060_RS10750 (WJ060_10730) | - | 2146219..2146836 (-) | 618 | WP_064135358.1 | MBL fold metallo-hydrolase | - |
| WJ060_RS10755 (WJ060_10735) | - | 2146917..2147837 (-) | 921 | WP_000180598.1 | recombinase RecT | - |
| WJ060_RS10760 (WJ060_10740) | - | 2147839..2149782 (-) | 1944 | WP_000700555.1 | AAA family ATPase | - |
| WJ060_RS10765 (WJ060_10745) | - | 2149791..2150054 (-) | 264 | WP_001205732.1 | hypothetical protein | - |
| WJ060_RS10770 (WJ060_10750) | - | 2150063..2150323 (-) | 261 | WP_001814567.1 | DUF1108 family protein | - |
| WJ060_RS10775 (WJ060_10755) | - | 2150304..2150633 (-) | 330 | WP_000138304.1 | hypothetical protein | - |
| WJ060_RS10780 (WJ060_10760) | - | 2150723..2150884 (-) | 162 | WP_000066017.1 | DUF1270 domain-containing protein | - |
| WJ060_RS10785 (WJ060_10765) | - | 2150881..2151201 (-) | 321 | WP_001120197.1 | DUF771 domain-containing protein | - |
| WJ060_RS10790 (WJ060_10770) | - | 2151260..2151892 (+) | 633 | WP_000275058.1 | hypothetical protein | - |
| WJ060_RS10795 (WJ060_10775) | - | 2151907..2152047 (-) | 141 | WP_000939496.1 | hypothetical protein | - |
| WJ060_RS10800 (WJ060_10780) | - | 2152078..2152275 (-) | 198 | WP_001148861.1 | hypothetical protein | - |
| WJ060_RS10805 (WJ060_10785) | - | 2152291..2153040 (-) | 750 | WP_001148653.1 | phage antirepressor KilAC domain-containing protein | - |
| WJ060_RS10810 (WJ060_10790) | - | 2153091..2153420 (+) | 330 | WP_000180411.1 | hypothetical protein | - |
| WJ060_RS10815 (WJ060_10795) | - | 2153409..2153624 (-) | 216 | WP_001025404.1 | MW1434 family type I TA system toxin | - |
| WJ060_RS10820 (WJ060_10800) | - | 2153640..2153903 (-) | 264 | WP_000854072.1 | helix-turn-helix transcriptional regulator | - |
| WJ060_RS10825 (WJ060_10805) | - | 2153900..2154073 (-) | 174 | WP_001801500.1 | hypothetical protein | - |
| WJ060_RS10830 (WJ060_10810) | - | 2154036..2154749 (+) | 714 | WP_001031454.1 | XRE family transcriptional regulator | - |
| WJ060_RS10835 (WJ060_10815) | - | 2154765..2155697 (+) | 933 | WP_000759682.1 | exonuclease domain-containing protein | - |
| WJ060_RS10840 (WJ060_10820) | - | 2155703..2156044 (+) | 342 | WP_000591749.1 | hypothetical protein | - |
| WJ060_RS10845 (WJ060_10825) | - | 2156248..2156430 (+) | 183 | WP_000705248.1 | hypothetical protein | - |
| WJ060_RS10850 (WJ060_10830) | - | 2156530..2156994 (+) | 465 | WP_000825947.1 | hypothetical protein | - |
| WJ060_RS10855 (WJ060_10835) | - | 2157053..2158090 (+) | 1038 | WP_000857191.1 | site-specific integrase | - |
| WJ060_RS10860 (WJ060_10840) | sph | 2158147..2158971 (+) | 825 | Protein_2105 | sphingomyelin phosphodiesterase | - |
| WJ060_RS10865 (WJ060_10845) | lukG | 2159209..2160225 (-) | 1017 | WP_000595324.1 | bi-component leukocidin LukGH subunit G | - |
| WJ060_RS10870 (WJ060_10850) | lukH | 2160247..2161302 (-) | 1056 | WP_000791407.1 | bi-component leukocidin LukGH subunit H | - |
| WJ060_RS10875 (WJ060_10855) | - | 2161737..2162960 (+) | 1224 | WP_000206638.1 | ArgE/DapE family deacylase | - |
| WJ060_RS10880 (WJ060_10860) | - | 2163332..2164175 (-) | 844 | Protein_2109 | class I SAM-dependent methyltransferase | - |
| WJ060_RS10885 (WJ060_10865) | - | 2164237..2165148 (-) | 912 | WP_000825510.1 | iron-hydroxamate ABC transporter substrate-binding protein | - |
| WJ060_RS10890 (WJ060_10870) | - | 2165309..2166616 (+) | 1308 | WP_001045079.1 | TrkH family potassium uptake protein | - |
| WJ060_RS10895 (WJ060_10875) | - | 2167469..2167912 (-) | 444 | WP_000022887.1 | GNAT family N-acetyltransferase | - |
| WJ060_RS10900 (WJ060_10880) | - | 2168018..2168454 (-) | 437 | Protein_2113 | hypothetical protein | - |
| WJ060_RS10905 (WJ060_10885) | - | 2168772..2169362 (-) | 591 | WP_001293058.1 | terminase small subunit | - |
| WJ060_RS10910 (WJ060_10890) | - | 2169359..2169571 (-) | 213 | WP_000128898.1 | LuxR C-terminal-related transcriptional regulator | - |
| WJ060_RS10915 (WJ060_10895) | - | 2169632..2170178 (+) | 547 | Protein_2116 | site-specific integrase | - |
| WJ060_RS10920 (WJ060_10900) | groL | 2170273..2171889 (-) | 1617 | WP_000240653.1 | chaperonin GroEL | - |
| WJ060_RS10925 (WJ060_10905) | groES | 2171965..2172249 (-) | 285 | WP_000917288.1 | co-chaperone GroES | - |
| WJ060_RS10930 (WJ060_10910) | mroQ | 2172424..2173167 (+) | 744 | WP_000197635.1 | CPBP family intramembrane glutamic endopeptidase MroQ | - |
| WJ060_RS10935 (WJ060_10915) | - | 2173192..2174451 (-) | 1260 | WP_000120305.1 | SdrH family protein | - |
| WJ060_RS10940 (WJ060_10920) | - | 2174648..2175274 (+) | 627 | WP_000522384.1 | nitroreductase family protein | - |
Sequence
Protein
Download Length: 156 a.a. Molecular weight: 17641.52 Da Isoelectric Point: 5.2672
>NTDB_id=959542 WJ060_RS10745 WP_000934759.1 2145748..2146218(-) (ssbA) [Staphylococcus aureus strain BPH2947]
MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIEIDDNDLPF
MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIEIDDNDLPF
Nucleotide
Download Length: 471 bp
>NTDB_id=959542 WJ060_RS10745 WP_000934759.1 2145748..2146218(-) (ssbA) [Staphylococcus aureus strain BPH2947]
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGCACATTTACGAATGCACAAGGAGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGGCGGGCGTAGATGGTAGGTTACAAACGCGG
AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATATCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAAATAGATGACAATGATTTACCATTCTAA
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGCACATTTACGAATGCACAAGGAGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGGCGGGCGTAGATGGTAGGTTACAAACGCGG
AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATATCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAAATAGATGACAATGATTTACCATTCTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
55.932 |
100 |
0.635 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
50.588 |
100 |
0.551 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
59.434 |
67.949 |
0.404 |
| ssb | Glaesserella parasuis strain SC1401 |
32.203 |
100 |
0.365 |