Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | WJ060_RS01800 | Genome accession | NZ_CP149492 |
| Coordinates | 389404..389874 (+) | Length | 156 a.a. |
| NCBI ID | WP_000934759.1 | Uniprot ID | A0A2I7Y8V1 |
| Organism | Staphylococcus aureus strain BPH2947 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 378818..421315 | 389404..389874 | within | 0 |
Gene organization within MGE regions
Location: 378818..421315
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| WJ060_RS01715 (WJ060_01710) | - | 378818..380023 (-) | 1206 | WP_000264186.1 | tyrosine-type recombinase/integrase | - |
| WJ060_RS01720 (WJ060_01715) | - | 380134..380313 (+) | 180 | WP_000337826.1 | hypothetical protein | - |
| WJ060_RS01725 (WJ060_01720) | - | 380293..381225 (-) | 933 | WP_000392181.1 | hypothetical protein | - |
| WJ060_RS01730 (WJ060_01725) | - | 381257..381982 (-) | 726 | WP_000661437.1 | PH domain-containing protein | - |
| WJ060_RS01735 (WJ060_01730) | - | 382010..382684 (-) | 675 | WP_000775187.1 | ImmA/IrrE family metallo-endopeptidase | - |
| WJ060_RS01740 (WJ060_01735) | - | 382701..383033 (-) | 333 | WP_001055143.1 | helix-turn-helix domain-containing protein | - |
| WJ060_RS01745 (WJ060_01740) | - | 383297..383491 (+) | 195 | WP_000108122.1 | helix-turn-helix transcriptional regulator | - |
| WJ060_RS01750 (WJ060_01745) | - | 383491..384258 (+) | 768 | WP_001002757.1 | phage antirepressor Ant | - |
| WJ060_RS01755 (WJ060_01750) | tscA | 384259..384483 (+) | 225 | WP_000187184.1 | type II toxin-antitoxin system antitoxin TscA | - |
| WJ060_RS01760 (WJ060_01755) | - | 384523..384622 (+) | 100 | Protein_349 | hypothetical protein | - |
| WJ060_RS01765 (WJ060_01760) | - | 384771..385034 (+) | 264 | WP_001124198.1 | helix-turn-helix domain-containing protein | - |
| WJ060_RS01770 (WJ060_01765) | - | 385046..385207 (+) | 162 | WP_000066021.1 | DUF1270 family protein | - |
| WJ060_RS01775 (WJ060_01770) | - | 385299..385559 (+) | 261 | WP_000291089.1 | DUF1108 family protein | - |
| WJ060_RS01780 (WJ060_01775) | - | 385568..385831 (+) | 264 | WP_001205732.1 | hypothetical protein | - |
| WJ060_RS01785 (WJ060_01780) | - | 385840..387783 (+) | 1944 | WP_000700555.1 | AAA family ATPase | - |
| WJ060_RS01790 (WJ060_01785) | - | 387785..388705 (+) | 921 | WP_000180598.1 | recombinase RecT | - |
| WJ060_RS01795 (WJ060_01790) | - | 388786..389403 (+) | 618 | WP_064135358.1 | MBL fold metallo-hydrolase | - |
| WJ060_RS01800 (WJ060_01795) | ssbA | 389404..389874 (+) | 471 | WP_000934759.1 | single-stranded DNA-binding protein | Machinery gene |
| WJ060_RS01805 (WJ060_01800) | - | 389904..390797 (+) | 894 | WP_000148333.1 | DnaD domain-containing protein | - |
| WJ060_RS01810 (WJ060_01805) | - | 390804..391022 (+) | 219 | WP_000338528.1 | hypothetical protein | - |
| WJ060_RS01815 (WJ060_01810) | - | 391031..391435 (+) | 405 | WP_000401969.1 | RusA family crossover junction endodeoxyribonuclease | - |
| WJ060_RS01820 (WJ060_01815) | - | 391448..391820 (+) | 373 | Protein_361 | SA1788 family PVL leukocidin-associated protein | - |
| WJ060_RS01825 (WJ060_01820) | - | 391820..392077 (+) | 258 | WP_000111491.1 | DUF3310 domain-containing protein | - |
| WJ060_RS01830 (WJ060_01825) | - | 392080..392322 (+) | 243 | WP_000221871.1 | SAV1978 family virulence-associated passenger protein | - |
| WJ060_RS01835 (WJ060_01830) | - | 392335..392736 (+) | 402 | WP_000695762.1 | hypothetical protein | - |
| WJ060_RS01840 (WJ060_01835) | - | 392733..393080 (+) | 348 | WP_000979209.1 | YopX family protein | - |
| WJ060_RS01845 (WJ060_01840) | - | 393077..393385 (+) | 309 | WP_000144710.1 | hypothetical protein | - |
| WJ060_RS01850 (WJ060_01845) | - | 393378..393626 (+) | 249 | WP_001065026.1 | DUF1024 family protein | - |
| WJ060_RS01855 (WJ060_01850) | - | 393619..394155 (+) | 537 | WP_000185663.1 | dUTPase | - |
| WJ060_RS01860 (WJ060_01855) | - | 394192..394392 (+) | 201 | WP_000195821.1 | DUF1381 domain-containing protein | - |
| WJ060_RS01865 (WJ060_01860) | - | 394491..394727 (+) | 237 | WP_000608279.1 | hypothetical protein | - |
| WJ060_RS01870 (WJ060_01865) | rinB | 394720..394893 (+) | 174 | WP_000591891.1 | transcriptional activator RinB | - |
| WJ060_RS01875 (WJ060_01870) | - | 394894..395259 (+) | 366 | WP_000989954.1 | hypothetical protein | - |
| WJ060_RS01880 (WJ060_01875) | - | 395260..395406 (+) | 147 | WP_000989960.1 | hypothetical protein | - |
| WJ060_RS01885 (WJ060_01880) | - | 395430..395870 (+) | 441 | WP_000162703.1 | RinA family phage transcriptional activator | - |
| WJ060_RS01890 (WJ060_01885) | - | 396181..396675 (+) | 495 | WP_000594082.1 | terminase small subunit | - |
| WJ060_RS01895 (WJ060_01890) | - | 396668..397876 (+) | 1209 | WP_001606760.1 | PBSX family phage terminase large subunit | - |
| WJ060_RS01900 (WJ060_01895) | - | 397890..399308 (+) | 1419 | WP_000283553.1 | phage portal protein | - |
| WJ060_RS01905 (WJ060_01900) | - | 399247..400230 (+) | 984 | WP_014532414.1 | phage head morphogenesis protein | - |
| WJ060_RS01910 (WJ060_01905) | - | 400232..400438 (+) | 207 | WP_000346033.1 | hypothetical protein | - |
| WJ060_RS01915 (WJ060_01910) | - | 400543..401139 (+) | 597 | WP_000366932.1 | phage scaffolding protein | - |
| WJ060_RS01920 (WJ060_01915) | - | 401160..401984 (+) | 825 | WP_001135558.1 | N4-gp56 family major capsid protein | - |
| WJ060_RS01925 (WJ060_01920) | - | 402001..402327 (+) | 327 | WP_000278799.1 | Rho termination factor N-terminal domain-containing protein | - |
| WJ060_RS01930 (WJ060_01925) | - | 402327..402641 (+) | 315 | WP_000338935.1 | phage head-tail connector protein | - |
| WJ060_RS01935 (WJ060_01930) | - | 402634..402969 (+) | 336 | WP_017431444.1 | phage head closure protein | - |
| WJ060_RS01940 (WJ060_01935) | - | 402956..403369 (+) | 414 | WP_001151335.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| WJ060_RS01945 (WJ060_01940) | - | 403382..403819 (+) | 438 | WP_000270196.1 | DUF3168 domain-containing protein | - |
| WJ060_RS01950 (WJ060_01945) | - | 403806..404366 (+) | 561 | WP_000046067.1 | hypothetical protein | - |
| WJ060_RS01955 (WJ060_01950) | - | 404428..404922 (+) | 495 | WP_000141082.1 | tail assembly chaperone | - |
| WJ060_RS01960 (WJ060_01955) | - | 404943..405284 (+) | 342 | WP_001580347.1 | hypothetical protein | - |
| WJ060_RS01965 (WJ060_01960) | - | 405287..408256 (+) | 2970 | WP_000414234.1 | terminase | - |
| WJ060_RS01970 (WJ060_01965) | - | 408271..409206 (+) | 936 | WP_000560193.1 | phage tail domain-containing protein | - |
| WJ060_RS01975 (WJ060_01970) | - | 409217..411100 (+) | 1884 | WP_001144702.1 | SGNH/GDSL hydrolase family protein | - |
| WJ060_RS01980 (WJ060_01975) | - | 411113..413011 (+) | 1899 | WP_000323252.1 | hypothetical protein | - |
| WJ060_RS01985 (WJ060_01980) | - | 413011..414834 (+) | 1824 | WP_000259636.1 | phage baseplate upper protein | - |
| WJ060_RS01990 (WJ060_01985) | - | 414834..415211 (+) | 378 | WP_000869363.1 | DUF2977 domain-containing protein | - |
| WJ060_RS01995 (WJ060_01990) | - | 415221..415394 (+) | 174 | WP_015990323.1 | XkdX family protein | - |
| WJ060_RS02000 (WJ060_01995) | - | 415435..415734 (+) | 300 | WP_000466769.1 | DUF2951 domain-containing protein | - |
| WJ060_RS02005 (WJ060_02000) | - | 415871..417745 (+) | 1875 | WP_000524040.1 | glucosaminidase domain-containing protein | - |
| WJ060_RS02010 (WJ060_02005) | - | 417758..418996 (+) | 1239 | WP_000276640.1 | BppU family phage baseplate upper protein | - |
| WJ060_RS02015 (WJ060_02010) | - | 419001..419396 (+) | 396 | WP_000387945.1 | hypothetical protein | - |
| WJ060_RS02020 (WJ060_02015) | - | 419452..419889 (+) | 438 | WP_000354132.1 | phage holin | - |
| WJ060_RS02025 (WJ060_02020) | - | 419870..421315 (+) | 1446 | WP_129760456.1 | SH3 domain-containing protein | - |
Sequence
Protein
Download Length: 156 a.a. Molecular weight: 17641.52 Da Isoelectric Point: 5.2672
>NTDB_id=959510 WJ060_RS01800 WP_000934759.1 389404..389874(+) (ssbA) [Staphylococcus aureus strain BPH2947]
MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIEIDDNDLPF
MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIEIDDNDLPF
Nucleotide
Download Length: 471 bp
>NTDB_id=959510 WJ060_RS01800 WP_000934759.1 389404..389874(+) (ssbA) [Staphylococcus aureus strain BPH2947]
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGCACATTTACGAATGCACAAGGAGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGGCGGGCGTAGATGGTAGGTTACAAACGCGG
AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATATCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAAATAGATGACAATGATTTACCATTCTAA
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGCACATTTACGAATGCACAAGGAGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGGCGGGCGTAGATGGTAGGTTACAAACGCGG
AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATATCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAAATAGATGACAATGATTTACCATTCTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
55.932 |
100 |
0.635 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
50.588 |
100 |
0.551 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
59.434 |
67.949 |
0.404 |
| ssb | Glaesserella parasuis strain SC1401 |
32.203 |
100 |
0.365 |