Detailed information
Overview
| Name | comGF/cglF | Type | Machinery gene |
| Locus tag | ACG3JE_RS00495 | Genome accession | NZ_CP171736 |
| Coordinates | 81272..81487 (+) | Length | 71 a.a. |
| NCBI ID | WP_311981290.1 | Uniprot ID | - |
| Organism | Streptococcus parauberis strain DB-M17 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Genomic Context
Location: 76272..86487
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ACG3JE_RS00455 (ACG3JE_00455) | - | 77696..78034 (+) | 339 | WP_013794400.1 | DUF1366 domain-containing protein | - |
| ACG3JE_RS00460 (ACG3JE_00460) | - | 78097..78246 (+) | 150 | WP_259966511.1 | hypothetical protein | - |
| ACG3JE_RS00465 (ACG3JE_00465) | - | 78250..78714 (+) | 465 | WP_013794399.1 | phage holin family protein | - |
| ACG3JE_RS00470 (ACG3JE_00470) | - | 78707..79432 (+) | 726 | WP_013794398.1 | peptidoglycan amidohydrolase family protein | - |
| ACG3JE_RS00475 (ACG3JE_00475) | comGC | 80085..80405 (+) | 321 | WP_013794397.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| ACG3JE_RS00480 (ACG3JE_00480) | comGD | 80395..80802 (+) | 408 | WP_243619590.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
| ACG3JE_RS00485 (ACG3JE_00485) | comGE | 80774..81073 (+) | 300 | WP_259966510.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| ACG3JE_RS00490 (ACG3JE_00490) | comGF | 81051..81299 (+) | 249 | WP_311981289.1 | hypothetical protein | Machinery gene |
| ACG3JE_RS00495 (ACG3JE_00495) | comGF/cglF | 81272..81487 (+) | 216 | WP_311981290.1 | ComGF family competence protein | Machinery gene |
| ACG3JE_RS00500 (ACG3JE_00500) | comGG | 81465..81962 (+) | 498 | WP_003108640.1 | competence type IV pilus minor pilin ComGG | - |
| ACG3JE_RS00505 (ACG3JE_00505) | comGH | 82069..83025 (+) | 957 | WP_003103712.1 | class I SAM-dependent methyltransferase | Machinery gene |
| ACG3JE_RS00510 (ACG3JE_00510) | - | 83081..84274 (+) | 1194 | WP_003108638.1 | acetate kinase | - |
| ACG3JE_RS00515 (ACG3JE_00515) | - | 84385..84597 (+) | 213 | WP_003108636.1 | helix-turn-helix transcriptional regulator | - |
| ACG3JE_RS00520 (ACG3JE_00520) | - | 84590..85042 (+) | 453 | WP_003108634.1 | hypothetical protein | - |
| ACG3JE_RS00525 (ACG3JE_00525) | - | 85051..85704 (+) | 654 | WP_013794395.1 | CPBP family intramembrane glutamic endopeptidase | - |
Sequence
Protein
Download Length: 71 a.a. Molecular weight: 8221.55 Da Isoelectric Point: 9.8157
>NTDB_id=948805 ACG3JE_RS00495 WP_311981290.1 81272..81487(+) (comGF/cglF) [Streptococcus parauberis strain DB-M17]
MLVKKDEKVVSFRLTEKNDFRKSAASGKGLNPMLLNLQDIQMTTVNHQLTLHLIWQSGLERDFIYAFEKPS
MLVKKDEKVVSFRLTEKNDFRKSAASGKGLNPMLLNLQDIQMTTVNHQLTLHLIWQSGLERDFIYAFEKPS
Nucleotide
Download Length: 216 bp
>NTDB_id=948805 ACG3JE_RS00495 WP_311981290.1 81272..81487(+) (comGF/cglF) [Streptococcus parauberis strain DB-M17]
ATGCTTGTTAAAAAGGATGAAAAGGTAGTTTCTTTTAGATTAACTGAAAAAAATGACTTTAGAAAATCGGCAGCTAGTGG
GAAAGGCTTAAATCCAATGTTGTTAAACTTACAGGATATTCAAATGACGACAGTAAATCACCAACTAACTCTTCATTTGA
TCTGGCAAAGTGGCCTGGAAAGGGATTTTATCTATGCATTTGAGAAGCCAAGTTAA
ATGCTTGTTAAAAAGGATGAAAAGGTAGTTTCTTTTAGATTAACTGAAAAAAATGACTTTAGAAAATCGGCAGCTAGTGG
GAAAGGCTTAAATCCAATGTTGTTAAACTTACAGGATATTCAAATGACGACAGTAAATCACCAACTAACTCTTCATTTGA
TCTGGCAAAGTGGCCTGGAAAGGGATTTTATCTATGCATTTGAGAAGCCAAGTTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGF/cglF | Streptococcus mitis SK321 |
40 |
98.592 |
0.394 |
| comGF/cglF | Streptococcus mitis NCTC 12261 |
38.571 |
98.592 |
0.38 |
| comGF/cglF | Streptococcus pneumoniae Rx1 |
37.143 |
98.592 |
0.366 |
| comGF/cglF | Streptococcus pneumoniae D39 |
37.143 |
98.592 |
0.366 |
| comGF/cglF | Streptococcus pneumoniae R6 |
37.143 |
98.592 |
0.366 |
| comGF/cglF | Streptococcus pneumoniae TIGR4 |
37.143 |
98.592 |
0.366 |