Detailed information NTG0948500

Bioinformatically predicted

Overview

• Name: comGF/cglF
• Type: Machinery gene
• Locus tag: ACG3JJ_RS00975
• Genome accession: NZ_CP171733
• Coordinates: 192443..192880 (-)
• Length: 145 a.a.
• NCBI ID: WP_003102915.1
• Uniprot ID: A0ABN0IPC0
• Organism: Streptococcus parauberis strain DB-M5
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 187443..197880

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
ACG3JJ_RS00945 (ACG3JJ_00945)	-	188226..188879 (-)	654	WP_013794395.1	CPBP family intramembrane glutamic endopeptidase	-
ACG3JJ_RS00950 (ACG3JJ_00950)	-	188888..189340 (-)	453	WP_003108634.1	hypothetical protein	-
ACG3JJ_RS00955 (ACG3JJ_00955)	-	189333..189545 (-)	213	WP_003108636.1	helix-turn-helix transcriptional regulator	-
ACG3JJ_RS00960 (ACG3JJ_00960)	-	189656..190849 (-)	1194	WP_003108638.1	acetate kinase	-
ACG3JJ_RS00965 (ACG3JJ_00965)	comGH	190905..191861 (-)	957	WP_003103712.1	class I SAM-dependent methyltransferase	Machinery gene
ACG3JJ_RS00970 (ACG3JJ_00970)	comGG	191968..192465 (-)	498	WP_003108640.1	competence type IV pilus minor pilin ComGG	-
ACG3JJ_RS00975 (ACG3JJ_00975)	comGF/cglF	192443..192880 (-)	438	WP_003102915.1	competence type IV pilus minor pilin ComGF	Machinery gene
ACG3JJ_RS00980 (ACG3JJ_00980)	comGE	192858..193157 (-)	300	WP_259966510.1	competence type IV pilus minor pilin ComGE	Machinery gene
ACG3JJ_RS00985 (ACG3JJ_00985)	comGD	193129..193572 (-)	444	WP_307877782.1	competence type IV pilus minor pilin ComGD	Machinery gene
ACG3JJ_RS00990 (ACG3JJ_00990)	comGC	193526..193846 (-)	321	WP_013794397.1	competence type IV pilus major pilin ComGC	Machinery gene
ACG3JJ_RS00995 (ACG3JJ_00995)	-	194499..195224 (-)	726	WP_013794398.1	peptidoglycan amidohydrolase family protein	-
ACG3JJ_RS01000 (ACG3JJ_01000)	-	195217..195681 (-)	465	WP_013794399.1	phage holin family protein	-
ACG3JJ_RS01005 (ACG3JJ_01005)	-	195685..195834 (-)	150	WP_259966511.1	hypothetical protein	-
ACG3JJ_RS01010 (ACG3JJ_01010)	-	195897..196235 (-)	339	WP_013794400.1	DUF1366 domain-containing protein	-

Sequence

Protein

• Length: 145 a.a.
• Molecular weight: 16538.25 Da
• Isoelectric Point: 9.7525

>NTDB_id=948500 ACG3JJ_RS00975 WP_003102915.1 192443..192880(-) (comGF/cglF) [Streptococcus parauberis strain DB-M5]
MLQKLVTKGFTLFEALIALLVISGSLLVYQGLTKSTFANMNYLSQSDQDSWLLFANQFRAELEGSQFIEIKGKKMLVKKD
EKVVSFRLTEKNDFRKSAASGKGLNPMLLNLQDIQMTTVNHQLTLHLIWQSGLERDFIYAFEKPS

Nucleotide

• Length: 438 bp

>NTDB_id=948500 ACG3JJ_RS00975 WP_003102915.1 192443..192880(-) (comGF/cglF) [Streptococcus parauberis strain DB-M5]
ATGTTACAAAAATTAGTGACTAAGGGTTTTACCTTATTTGAAGCCTTAATTGCACTTTTAGTTATCTCTGGATCTCTACT
GGTTTATCAAGGTTTAACTAAGTCAACGTTTGCCAATATGAACTATCTAAGTCAAAGTGATCAAGATAGTTGGCTCTTAT
TTGCAAATCAGTTTAGAGCTGAATTGGAAGGTTCACAATTTATTGAAATTAAAGGAAAAAAAATGCTTGTTAAAAAGGAT
GAAAAGGTAGTTTCTTTTAGATTAACTGAAAAAAATGACTTTAGAAAATCGGCAGCTAGTGGGAAAGGCTTAAATCCAAT
GTTGTTAAACTTACAGGATATTCAAATGACGACAGTAAATCACCAACTAACTCTTCATTTGATCTGGCAAAGTGGCCTGG
AAAGGGATTTTATCTATGCATTTGAGAAGCCAAGTTAA

Domains

Predicted by InterProScan.

• Putative Competence protein ComGF (ComGF) (41-134)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGF/cglF	Streptococcus mitis SK321	44.928	95.172	0.428
comGF/cglF	Streptococcus mitis NCTC 12261	43.796	94.483	0.414
comGF	Streptococcus mutans UA140	42.029	95.172	0.4
comGF	Streptococcus mutans UA159	41.304	95.172	0.393
comGF/cglF	Streptococcus pneumoniae R6	40.58	95.172	0.386
comGF/cglF	Streptococcus pneumoniae TIGR4	40.58	95.172	0.386
comGF/cglF	Streptococcus pneumoniae D39	40.58	95.172	0.386
comGF/cglF	Streptococcus pneumoniae Rx1	40.58	95.172	0.386