Detailed information NTG0948469

Bioinformatically predicted

Overview

• Name: comGF/cglF
• Type: Machinery gene
• Locus tag: ACG3JF_RS07440
• Genome accession: NZ_CP171732
• Coordinates: 1469937..1470374 (+)
• Length: 145 a.a.
• NCBI ID: WP_003102915.1
• Uniprot ID: A0ABN0IPC0
• Organism: Streptococcus parauberis strain DB-M3
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1464937..1475374

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
ACG3JF_RS07405 (ACG3JF_07405)	-	1466582..1466920 (+)	339	WP_013794400.1	DUF1366 domain-containing protein	-
ACG3JF_RS07410 (ACG3JF_07410)	-	1466983..1467132 (+)	150	WP_259966511.1	hypothetical protein	-
ACG3JF_RS07415 (ACG3JF_07415)	-	1467136..1467600 (+)	465	WP_013794399.1	phage holin family protein	-
ACG3JF_RS07420 (ACG3JF_07420)	-	1467593..1468318 (+)	726	WP_013794398.1	peptidoglycan amidohydrolase family protein	-
ACG3JF_RS07425 (ACG3JF_07425)	comGC	1468971..1469291 (+)	321	WP_013794397.1	competence type IV pilus major pilin ComGC	Machinery gene
ACG3JF_RS07430 (ACG3JF_07430)	comGD	1469281..1469688 (+)	408	WP_243619590.1	competence type IV pilus minor pilin ComGD	Machinery gene
ACG3JF_RS07435 (ACG3JF_07435)	comGE	1469660..1469959 (+)	300	WP_259966510.1	competence type IV pilus minor pilin ComGE	Machinery gene
ACG3JF_RS07440 (ACG3JF_07440)	comGF/cglF	1469937..1470374 (+)	438	WP_003102915.1	competence type IV pilus minor pilin ComGF	Machinery gene
ACG3JF_RS07445 (ACG3JF_07445)	comGG	1470403..1470849 (+)	447	WP_238570152.1	competence type IV pilus minor pilin ComGG	-
ACG3JF_RS07450 (ACG3JF_07450)	comGH	1470956..1471912 (+)	957	WP_003103712.1	class I SAM-dependent methyltransferase	Machinery gene
ACG3JF_RS07455 (ACG3JF_07455)	-	1471968..1473161 (+)	1194	WP_003108638.1	acetate kinase	-
ACG3JF_RS07460 (ACG3JF_07460)	-	1473272..1473484 (+)	213	WP_003108636.1	helix-turn-helix transcriptional regulator	-
ACG3JF_RS07465 (ACG3JF_07465)	-	1473477..1473929 (+)	453	WP_003108634.1	hypothetical protein	-
ACG3JF_RS07470 (ACG3JF_07470)	-	1473938..1474591 (+)	654	WP_013794395.1	CPBP family intramembrane glutamic endopeptidase	-

Sequence

Protein

• Length: 145 a.a.
• Molecular weight: 16538.25 Da
• Isoelectric Point: 9.7525

>NTDB_id=948469 ACG3JF_RS07440 WP_003102915.1 1469937..1470374(+) (comGF/cglF) [Streptococcus parauberis strain DB-M3]
MLQKLVTKGFTLFEALIALLVISGSLLVYQGLTKSTFANMNYLSQSDQDSWLLFANQFRAELEGSQFIEIKGKKMLVKKD
EKVVSFRLTEKNDFRKSAASGKGLNPMLLNLQDIQMTTVNHQLTLHLIWQSGLERDFIYAFEKPS

Nucleotide

• Length: 438 bp

>NTDB_id=948469 ACG3JF_RS07440 WP_003102915.1 1469937..1470374(+) (comGF/cglF) [Streptococcus parauberis strain DB-M3]
ATGTTACAAAAATTAGTGACTAAGGGTTTTACCTTATTTGAAGCCTTAATTGCACTTTTAGTTATCTCTGGATCTCTACT
GGTTTATCAAGGTTTAACTAAGTCAACGTTTGCCAATATGAACTATCTAAGTCAAAGTGATCAAGATAGTTGGCTCTTAT
TTGCAAATCAGTTTAGAGCTGAATTGGAAGGTTCACAATTTATTGAAATTAAAGGAAAAAAAATGCTTGTTAAAAAGGAT
GAAAAGGTAGTTTCTTTTAGATTAACTGAAAAAAATGACTTTAGAAAATCGGCAGCTAGTGGGAAAGGCTTAAATCCAAT
GTTGTTAAACTTACAGGATATTCAAATGACGACAGTAAATCACCAACTAACTCTTCATTTGATCTGGCAAAGTGGCCTGG
AAAGGGATTTTATCTATGCATTTGAGAAGCCAAGTTAA

Domains

Predicted by InterProScan.

• Putative Competence protein ComGF (ComGF) (41-134)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGF/cglF	Streptococcus mitis SK321	44.928	95.172	0.428
comGF/cglF	Streptococcus mitis NCTC 12261	43.796	94.483	0.414
comGF	Streptococcus mutans UA140	42.029	95.172	0.4
comGF	Streptococcus mutans UA159	41.304	95.172	0.393
comGF/cglF	Streptococcus pneumoniae R6	40.58	95.172	0.386
comGF/cglF	Streptococcus pneumoniae TIGR4	40.58	95.172	0.386
comGF/cglF	Streptococcus pneumoniae D39	40.58	95.172	0.386
comGF/cglF	Streptococcus pneumoniae Rx1	40.58	95.172	0.386