Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | WA084_RS09495 | Genome accession | NZ_CP146920 |
| Coordinates | 1977687..1978139 (+) | Length | 150 a.a. |
| NCBI ID | WP_099803107.1 | Uniprot ID | - |
| Organism | Pasteurella multocida strain 212516 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1933911..1982002 | 1977687..1978139 | within | 0 |
Gene organization within MGE regions
Location: 1933911..1982002
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| WA084_RS09200 | - | 1933911..1934423 (+) | 513 | WP_014390763.1 | hypothetical protein | - |
| WA084_RS09205 | - | 1934423..1935169 (+) | 747 | WP_014390762.1 | hypothetical protein | - |
| WA084_RS09210 | - | 1935560..1935883 (-) | 324 | WP_014390761.1 | hypothetical protein | - |
| WA084_RS09215 | - | 1935931..1940934 (-) | 5004 | WP_079157784.1 | phage tail protein | - |
| WA084_RS09220 | - | 1940938..1941561 (-) | 624 | WP_078819659.1 | tail assembly protein | - |
| WA084_RS09225 | - | 1941504..1942247 (-) | 744 | WP_079157783.1 | C40 family peptidase | - |
| WA084_RS09230 | - | 1942251..1942964 (-) | 714 | WP_079157782.1 | phage minor tail protein L | - |
| WA084_RS09235 | - | 1943253..1943603 (-) | 351 | WP_005719622.1 | phage tail protein | - |
| WA084_RS09240 | - | 1943600..1945993 (-) | 2394 | WP_170356808.1 | phage tail length tape measure family protein | - |
| WA084_RS09245 | - | 1945980..1946285 (-) | 306 | WP_306556893.1 | phage tail assembly protein T | - |
| WA084_RS09250 | - | 1946303..1946692 (-) | 390 | WP_014391488.1 | phage minor tail protein G | - |
| WA084_RS09255 | - | 1946695..1947204 (-) | 510 | WP_014391487.1 | phage tail tube protein | - |
| WA084_RS09260 | gpU | 1947201..1947608 (-) | 408 | WP_014391486.1 | phage tail terminator protein | - |
| WA084_RS09265 | - | 1947605..1948156 (-) | 552 | WP_170356810.1 | phage tail protein | - |
| WA084_RS09270 | - | 1948156..1948449 (-) | 294 | WP_005719722.1 | hypothetical protein | - |
| WA084_RS09275 | - | 1948442..1948768 (-) | 327 | WP_016570083.1 | capsid cement protein | - |
| WA084_RS09280 | - | 1948840..1950867 (-) | 2028 | WP_170356812.1 | ClpP-like prohead protease/major capsid protein fusion protein | - |
| WA084_RS09285 | - | 1950800..1952341 (-) | 1542 | WP_170356815.1 | phage portal protein | - |
| WA084_RS09290 | - | 1952338..1952565 (-) | 228 | WP_240962717.1 | hypothetical protein | - |
| WA084_RS09295 | - | 1952556..1954664 (-) | 2109 | WP_170356818.1 | phage terminase large subunit family protein | - |
| WA084_RS09300 | - | 1954668..1955141 (-) | 474 | WP_170356821.1 | DUF1441 family protein | - |
| WA084_RS09305 | - | 1955431..1955691 (+) | 261 | WP_005720780.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| WA084_RS09310 | - | 1955727..1956095 (+) | 369 | WP_014391478.1 | helix-turn-helix transcriptional regulator | - |
| WA084_RS09315 | - | 1956305..1956661 (-) | 357 | WP_234514998.1 | DUF2570 family protein | - |
| WA084_RS09320 | - | 1956618..1957031 (-) | 414 | WP_079157772.1 | M15 family metallopeptidase | - |
| WA084_RS09325 | - | 1957024..1957386 (-) | 363 | WP_079157771.1 | phage holin, lambda family | - |
| WA084_RS09330 | - | 1957503..1958060 (+) | 558 | WP_079157770.1 | hypothetical protein | - |
| WA084_RS09335 | - | 1958187..1958804 (-) | 618 | WP_338705684.1 | KilA-N domain-containing protein | - |
| WA084_RS09340 | - | 1959294..1959794 (-) | 501 | WP_079157768.1 | hypothetical protein | - |
| WA084_RS09345 | - | 1959894..1960259 (-) | 366 | WP_099821838.1 | antiterminator Q family protein | - |
| WA084_RS09350 | - | 1960259..1960861 (-) | 603 | WP_099821839.1 | recombination protein NinG | - |
| WA084_RS09355 | - | 1960854..1961069 (-) | 216 | WP_014390727.1 | hypothetical protein | - |
| WA084_RS09360 | - | 1961143..1961793 (-) | 651 | WP_170353044.1 | metallophosphoesterase | - |
| WA084_RS09365 | - | 1961878..1962315 (-) | 438 | WP_064965060.1 | DUF1367 family protein | - |
| WA084_RS09370 | - | 1962324..1962854 (-) | 531 | WP_170356878.1 | MT-A70 family methyltransferase | - |
| WA084_RS09375 | - | 1962847..1963542 (-) | 696 | WP_170376580.1 | replication protein P | - |
| WA084_RS09380 | - | 1963542..1964441 (-) | 900 | WP_014390723.1 | hypothetical protein | - |
| WA084_RS09385 | - | 1964443..1964796 (-) | 354 | WP_014390722.1 | HNH endonuclease signature motif containing protein | - |
| WA084_RS09390 | - | 1964793..1965476 (-) | 684 | WP_014390721.1 | phage antirepressor KilAC domain-containing protein | - |
| WA084_RS09395 | - | 1965534..1965983 (-) | 450 | WP_099821840.1 | YmfL family putative regulatory protein | - |
| WA084_RS09400 | - | 1966032..1966232 (-) | 201 | WP_099821841.1 | YdaS family helix-turn-helix protein | - |
| WA084_RS09405 | - | 1966357..1967040 (+) | 684 | WP_099821842.1 | S24 family peptidase | - |
| WA084_RS09410 | - | 1967112..1968032 (+) | 921 | WP_079157963.1 | hypothetical protein | - |
| WA084_RS09415 | - | 1968180..1970114 (-) | 1935 | WP_079157962.1 | ATP-binding protein | - |
| WA084_RS09420 | - | 1970635..1970865 (+) | 231 | WP_079157961.1 | hypothetical protein | - |
| WA084_RS09425 | - | 1970878..1971048 (+) | 171 | WP_014391460.1 | hypothetical protein | - |
| WA084_RS09430 | - | 1971029..1971223 (-) | 195 | WP_014391459.1 | hypothetical protein | - |
| WA084_RS09435 | - | 1971520..1971708 (+) | 189 | WP_014391458.1 | hypothetical protein | - |
| WA084_RS09440 | - | 1971701..1971973 (-) | 273 | WP_014391457.1 | hypothetical protein | - |
| WA084_RS09445 | - | 1972151..1972531 (+) | 381 | WP_075271374.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
| WA084_RS09450 | - | 1972750..1973013 (+) | 264 | WP_071522857.1 | hypothetical protein | - |
| WA084_RS09455 | - | 1973101..1973898 (+) | 798 | WP_064964923.1 | hypothetical protein | - |
| WA084_RS09460 | - | 1974228..1974839 (+) | 612 | WP_250264891.1 | antA/AntB antirepressor family protein | - |
| WA084_RS09465 | - | 1974901..1975131 (-) | 231 | WP_223251317.1 | hypothetical protein | - |
| WA084_RS09470 | - | 1975279..1975578 (+) | 300 | WP_014390709.1 | hypothetical protein | - |
| WA084_RS09475 | - | 1975550..1975786 (+) | 237 | WP_170356872.1 | hypothetical protein | - |
| WA084_RS09480 | - | 1975799..1976086 (+) | 288 | WP_014391452.1 | hypothetical protein | - |
| WA084_RS09485 | - | 1976088..1977041 (+) | 954 | WP_014391451.1 | recombinase RecT | - |
| WA084_RS09490 | - | 1977028..1977687 (+) | 660 | WP_041423209.1 | translocation protein TolB precursor | - |
| WA084_RS09495 | ssb | 1977687..1978139 (+) | 453 | WP_099803107.1 | single-stranded DNA-binding protein | Machinery gene |
| WA084_RS09500 | - | 1978212..1978565 (+) | 354 | WP_016570064.1 | hypothetical protein | - |
| WA084_RS09505 | - | 1978637..1979425 (+) | 789 | WP_064964852.1 | DUF2303 family protein | - |
| WA084_RS09510 | - | 1979476..1980075 (+) | 600 | WP_014391447.1 | hypothetical protein | - |
| WA084_RS09515 | - | 1980210..1980707 (+) | 498 | WP_170356874.1 | DUF551 domain-containing protein | - |
| WA084_RS09520 | - | 1980716..1981069 (+) | 354 | WP_078819897.1 | hypothetical protein | - |
| WA084_RS09525 | - | 1981328..1981546 (+) | 219 | WP_005720317.1 | hypothetical protein | - |
| WA084_RS09530 | - | 1981560..1981775 (+) | 216 | WP_250264892.1 | hypothetical protein | - |
| WA084_RS09535 | - | 1981796..1982002 (+) | 207 | WP_186003596.1 | hypothetical protein | - |
Sequence
Protein
Download Length: 150 a.a. Molecular weight: 16887.72 Da Isoelectric Point: 6.9828
>NTDB_id=945091 WA084_RS09495 WP_099803107.1 1977687..1978139(+) (ssb) [Pasteurella multocida strain 212516]
MAGVNKVIIVGNLGNDPEIRTMPNGDPVAKISVATSESWIDKNTGERKTQTEWHSIVFYRRQAEICGQYLKKGSKVYVEG
RLRTRKWQDQNGQDRYTTEIQGDVLQMLDSRQDSQAQANAQAPQNNAYANAKAGKPVQQADNFEEDNIPF
MAGVNKVIIVGNLGNDPEIRTMPNGDPVAKISVATSESWIDKNTGERKTQTEWHSIVFYRRQAEICGQYLKKGSKVYVEG
RLRTRKWQDQNGQDRYTTEIQGDVLQMLDSRQDSQAQANAQAPQNNAYANAKAGKPVQQADNFEEDNIPF
Nucleotide
Download Length: 453 bp
>NTDB_id=945091 WA084_RS09495 WP_099803107.1 1977687..1978139(+) (ssb) [Pasteurella multocida strain 212516]
ATGGCTGGAGTAAATAAAGTAATTATCGTGGGAAATTTGGGAAACGATCCTGAAATCCGCACAATGCCAAATGGCGACCC
TGTTGCAAAAATCAGCGTCGCAACCAGTGAAAGCTGGATCGACAAAAATACTGGCGAACGAAAAACACAAACTGAATGGC
ATTCTATCGTGTTCTATCGTCGCCAAGCAGAAATTTGCGGTCAGTATCTCAAAAAAGGATCGAAAGTGTATGTGGAAGGG
CGTTTAAGAACTCGTAAATGGCAAGACCAAAACGGGCAAGACCGCTACACCACTGAAATCCAAGGCGACGTATTGCAGAT
GTTAGACAGTCGCCAAGATTCACAAGCACAAGCTAACGCACAAGCACCGCAAAACAACGCTTATGCGAATGCGAAAGCTG
GAAAGCCAGTGCAGCAAGCAGATAACTTTGAAGAGGATAATATCCCGTTCTGA
ATGGCTGGAGTAAATAAAGTAATTATCGTGGGAAATTTGGGAAACGATCCTGAAATCCGCACAATGCCAAATGGCGACCC
TGTTGCAAAAATCAGCGTCGCAACCAGTGAAAGCTGGATCGACAAAAATACTGGCGAACGAAAAACACAAACTGAATGGC
ATTCTATCGTGTTCTATCGTCGCCAAGCAGAAATTTGCGGTCAGTATCTCAAAAAAGGATCGAAAGTGTATGTGGAAGGG
CGTTTAAGAACTCGTAAATGGCAAGACCAAAACGGGCAAGACCGCTACACCACTGAAATCCAAGGCGACGTATTGCAGAT
GTTAGACAGTCGCCAAGATTCACAAGCACAAGCTAACGCACAAGCACCGCAAAACAACGCTTATGCGAATGCGAAAGCTG
GAAAGCCAGTGCAGCAAGCAGATAACTTTGAAGAGGATAATATCCCGTTCTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Glaesserella parasuis strain SC1401 |
62.431 |
100 |
0.753 |
| ssb | Vibrio cholerae strain A1552 |
52.74 |
97.333 |
0.513 |
| ssb | Neisseria gonorrhoeae MS11 |
46.043 |
92.667 |
0.427 |
| ssb | Neisseria meningitidis MC58 |
46.043 |
92.667 |
0.427 |