Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | V6V88_RS17290 | Genome accession | NZ_CP146253 |
| Coordinates | 3724429..3724938 (+) | Length | 169 a.a. |
| NCBI ID | WP_253856618.1 | Uniprot ID | - |
| Organism | Achromobacter sp. E1 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 3685702..3730158 | 3724429..3724938 | within | 0 |
Gene organization within MGE regions
Location: 3685702..3730158
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| V6V88_RS16990 (V6V88_16990) | - | 3685702..3686364 (+) | 663 | WP_338615697.1 | SOS response-associated peptidase family protein | - |
| V6V88_RS16995 (V6V88_16995) | - | 3686420..3686728 (+) | 309 | WP_338615698.1 | hypothetical protein | - |
| V6V88_RS17000 (V6V88_17000) | - | 3686785..3686994 (+) | 210 | WP_336298573.1 | type II toxin-antitoxin system HicA family toxin | - |
| V6V88_RS17005 (V6V88_17005) | - | 3687052..3687474 (+) | 423 | WP_338615702.1 | type II toxin-antitoxin system HicB family antitoxin | - |
| V6V88_RS17010 (V6V88_17010) | - | 3687577..3687978 (-) | 402 | WP_338615703.1 | hypothetical protein | - |
| V6V88_RS17015 (V6V88_17015) | - | 3687975..3688475 (-) | 501 | WP_338615704.1 | hypothetical protein | - |
| V6V88_RS17020 (V6V88_17020) | - | 3688472..3688750 (-) | 279 | WP_338615706.1 | hypothetical protein | - |
| V6V88_RS17025 (V6V88_17025) | - | 3688752..3689060 (-) | 309 | WP_108696865.1 | hypothetical protein | - |
| V6V88_RS17030 (V6V88_17030) | - | 3689230..3690303 (+) | 1074 | WP_338615708.1 | acyltransferase | - |
| V6V88_RS17035 (V6V88_17035) | - | 3690326..3690757 (-) | 432 | WP_179689449.1 | hypothetical protein | - |
| V6V88_RS17040 (V6V88_17040) | - | 3690760..3691482 (-) | 723 | WP_338615712.1 | hypothetical protein | - |
| V6V88_RS17045 (V6V88_17045) | - | 3691483..3692133 (-) | 651 | WP_338615713.1 | DUF2612 domain-containing protein | - |
| V6V88_RS17050 (V6V88_17050) | - | 3692130..3693320 (-) | 1191 | WP_179689452.1 | baseplate J/gp47 family protein | - |
| V6V88_RS17055 (V6V88_17055) | - | 3693313..3693657 (-) | 345 | WP_338615715.1 | hypothetical protein | - |
| V6V88_RS17060 (V6V88_17060) | - | 3693654..3694361 (-) | 708 | WP_338615716.1 | Gp138 family membrane-puncturing spike protein | - |
| V6V88_RS17065 (V6V88_17065) | - | 3694346..3695170 (-) | 825 | WP_271265346.1 | hypothetical protein | - |
| V6V88_RS17070 (V6V88_17070) | - | 3695163..3695471 (-) | 309 | WP_338615719.1 | hypothetical protein | - |
| V6V88_RS17075 (V6V88_17075) | - | 3695468..3696010 (-) | 543 | WP_338615720.1 | phage baseplate protein | - |
| V6V88_RS17080 (V6V88_17080) | - | 3696010..3697866 (-) | 1857 | WP_338615722.1 | phage tail tape measure protein | - |
| V6V88_RS17085 (V6V88_17085) | - | 3697957..3698412 (-) | 456 | WP_179689457.1 | hypothetical protein | - |
| V6V88_RS17090 (V6V88_17090) | - | 3698422..3698871 (-) | 450 | WP_108696878.1 | hypothetical protein | - |
| V6V88_RS17095 (V6V88_17095) | - | 3698929..3700437 (-) | 1509 | WP_338615724.1 | DUF3383 domain-containing protein | - |
| V6V88_RS17100 (V6V88_17100) | - | 3700447..3700974 (-) | 528 | WP_338615725.1 | hypothetical protein | - |
| V6V88_RS17105 (V6V88_17105) | - | 3700971..3701339 (-) | 369 | WP_338615727.1 | hypothetical protein | - |
| V6V88_RS17110 (V6V88_17110) | - | 3701336..3701812 (-) | 477 | WP_338615730.1 | hypothetical protein | - |
| V6V88_RS17115 (V6V88_17115) | - | 3701809..3702237 (-) | 429 | WP_338615732.1 | DUF4054 domain-containing protein | - |
| V6V88_RS17120 (V6V88_17120) | - | 3702239..3702589 (-) | 351 | WP_063954325.1 | hypothetical protein | - |
| V6V88_RS17125 (V6V88_17125) | - | 3702649..3703731 (-) | 1083 | WP_338615734.1 | major capsid family protein | - |
| V6V88_RS17130 (V6V88_17130) | - | 3703752..3704252 (-) | 501 | WP_338615736.1 | hypothetical protein | - |
| V6V88_RS17135 (V6V88_17135) | - | 3704249..3705502 (-) | 1254 | WP_338615737.1 | DUF2213 domain-containing protein | - |
| V6V88_RS17140 (V6V88_17140) | - | 3705483..3706235 (-) | 753 | WP_338615739.1 | minor capsid protein | - |
| V6V88_RS17145 (V6V88_17145) | - | 3706255..3707763 (-) | 1509 | WP_338615740.1 | DUF1073 domain-containing protein | - |
| V6V88_RS17150 (V6V88_17150) | - | 3707760..3709097 (-) | 1338 | WP_338615741.1 | PBSX family phage terminase large subunit | - |
| V6V88_RS17155 (V6V88_17155) | - | 3709069..3709728 (-) | 660 | WP_338615742.1 | hypothetical protein | - |
| V6V88_RS17160 (V6V88_17160) | - | 3710015..3710956 (+) | 942 | WP_338615743.1 | putative phage abortive infection protein | - |
| V6V88_RS17165 (V6V88_17165) | - | 3711203..3711484 (+) | 282 | WP_338615744.1 | CRISPR-associated protein Cas2 | - |
| V6V88_RS17170 (V6V88_17170) | - | 3711493..3712713 (-) | 1221 | WP_338615745.1 | ISL3 family transposase | - |
| V6V88_RS17175 (V6V88_17175) | - | 3712834..3713136 (-) | 303 | WP_338615747.1 | hypothetical protein | - |
| V6V88_RS17180 (V6V88_17180) | - | 3713133..3713489 (-) | 357 | WP_338615748.1 | hypothetical protein | - |
| V6V88_RS17185 (V6V88_17185) | - | 3713482..3713685 (-) | 204 | WP_338615749.1 | hypothetical protein | - |
| V6V88_RS17190 (V6V88_17190) | - | 3713682..3714056 (-) | 375 | WP_338615750.1 | hypothetical protein | - |
| V6V88_RS17195 (V6V88_17195) | - | 3714053..3714736 (-) | 684 | WP_338615751.1 | hypothetical protein | - |
| V6V88_RS17200 (V6V88_17200) | - | 3714723..3715514 (-) | 792 | WP_338615753.1 | YdaU family protein | - |
| V6V88_RS17205 (V6V88_17205) | - | 3715501..3715857 (-) | 357 | WP_338615754.1 | GIY-YIG nuclease family protein | - |
| V6V88_RS17210 (V6V88_17210) | - | 3715854..3716213 (-) | 360 | WP_338615755.1 | Ref family recombination enhancement nuclease | - |
| V6V88_RS17215 (V6V88_17215) | - | 3716210..3716731 (-) | 522 | WP_338615756.1 | DUF1367 family protein | - |
| V6V88_RS17220 (V6V88_17220) | - | 3716733..3717047 (-) | 315 | WP_338615757.1 | CII family transcriptional regulator | - |
| V6V88_RS17225 (V6V88_17225) | - | 3717086..3717250 (+) | 165 | WP_338615758.1 | hypothetical protein | - |
| V6V88_RS17230 (V6V88_17230) | - | 3717321..3717641 (+) | 321 | WP_253856601.1 | hypothetical protein | - |
| V6V88_RS17235 (V6V88_17235) | - | 3717668..3717937 (-) | 270 | WP_338615762.1 | YdaS family helix-turn-helix protein | - |
| V6V88_RS17240 (V6V88_17240) | - | 3718009..3719109 (+) | 1101 | WP_338615763.1 | S24 family peptidase | - |
| V6V88_RS17245 (V6V88_17245) | - | 3719138..3719326 (-) | 189 | WP_338615764.1 | type II toxin-antitoxin system HicA family toxin | - |
| V6V88_RS17250 (V6V88_17250) | - | 3719323..3719598 (-) | 276 | WP_338615766.1 | DUF1902 domain-containing protein | - |
| V6V88_RS17255 (V6V88_17255) | - | 3720465..3720857 (+) | 393 | WP_338615768.1 | hypothetical protein | - |
| V6V88_RS17260 (V6V88_17260) | - | 3720860..3721237 (+) | 378 | WP_338615769.1 | hypothetical protein | - |
| V6V88_RS17265 (V6V88_17265) | - | 3721397..3721729 (+) | 333 | WP_338615770.1 | hypothetical protein | - |
| V6V88_RS17270 (V6V88_17270) | - | 3721726..3721905 (+) | 180 | WP_338615772.1 | hypothetical protein | - |
| V6V88_RS17275 (V6V88_17275) | - | 3721907..3723007 (+) | 1101 | WP_338615774.1 | hypothetical protein | - |
| V6V88_RS17280 (V6V88_17280) | - | 3723015..3723794 (+) | 780 | WP_338615775.1 | ERF family protein | - |
| V6V88_RS17285 (V6V88_17285) | - | 3723794..3724429 (+) | 636 | WP_338615777.1 | lambda exonuclease family protein | - |
| V6V88_RS17290 (V6V88_17290) | ssb | 3724429..3724938 (+) | 510 | WP_253856618.1 | single-stranded DNA-binding protein | Machinery gene |
| V6V88_RS17295 (V6V88_17295) | - | 3725781..3726113 (+) | 333 | WP_338615782.1 | hypothetical protein | - |
| V6V88_RS17300 (V6V88_17300) | - | 3726154..3726741 (+) | 588 | WP_338615785.1 | hypothetical protein | - |
| V6V88_RS17305 (V6V88_17305) | - | 3726857..3727189 (+) | 333 | Protein_3415 | DNA cytosine methyltransferase | - |
| V6V88_RS17310 (V6V88_17310) | - | 3727290..3727844 (+) | 555 | WP_338619747.1 | hypothetical protein | - |
| V6V88_RS17315 (V6V88_17315) | - | 3727846..3728205 (+) | 360 | WP_253856624.1 | hypothetical protein | - |
| V6V88_RS17320 (V6V88_17320) | - | 3728327..3728839 (+) | 513 | WP_338615789.1 | class I SAM-dependent methyltransferase | - |
| V6V88_RS17325 (V6V88_17325) | - | 3728832..3728972 (+) | 141 | WP_338615790.1 | hypothetical protein | - |
| V6V88_RS17330 (V6V88_17330) | - | 3729199..3730158 (+) | 960 | WP_338615792.1 | tyrosine-type recombinase/integrase | - |
Sequence
Protein
Download Length: 169 a.a. Molecular weight: 18639.66 Da Isoelectric Point: 5.9823
>NTDB_id=942364 V6V88_RS17290 WP_253856618.1 3724429..3724938(+) (ssb) [Achromobacter sp. E1]
MASVNKVILVGNLGRDPEVRYSPDGAAVCNLSLATTFSWKDKASGEKREETEWHRVVLYSRLAEIAGEYLKKGRSVYIEG
RLKTRKWQDKDTGADRYSTEIIADQMQMLGGREEGGSGGSGYDDAPRQQRAPAQRQAPQRNEYANQRGAAAPQSTPAASL
ADMDDDIPF
MASVNKVILVGNLGRDPEVRYSPDGAAVCNLSLATTFSWKDKASGEKREETEWHRVVLYSRLAEIAGEYLKKGRSVYIEG
RLKTRKWQDKDTGADRYSTEIIADQMQMLGGREEGGSGGSGYDDAPRQQRAPAQRQAPQRNEYANQRGAAAPQSTPAASL
ADMDDDIPF
Nucleotide
Download Length: 510 bp
>NTDB_id=942364 V6V88_RS17290 WP_253856618.1 3724429..3724938(+) (ssb) [Achromobacter sp. E1]
ATGGCCAGCGTCAATAAAGTCATCCTGGTGGGCAACCTGGGCCGCGACCCGGAGGTCCGTTACAGCCCAGACGGTGCGGC
CGTCTGCAACCTCTCCCTCGCGACGACGTTCAGTTGGAAAGACAAGGCCAGCGGCGAAAAGCGCGAAGAGACCGAATGGC
ACCGGGTCGTGTTGTACAGCCGCCTGGCGGAGATCGCCGGGGAGTACCTGAAGAAGGGCCGATCGGTCTACATCGAAGGC
CGACTCAAGACGCGCAAGTGGCAGGATAAAGACACCGGCGCAGACCGCTACAGCACTGAGATCATCGCAGACCAGATGCA
GATGCTGGGCGGTCGCGAAGAAGGCGGCAGCGGCGGCAGTGGATATGACGACGCGCCGCGCCAGCAGCGCGCGCCGGCGC
AACGCCAAGCGCCCCAACGCAACGAGTACGCGAACCAACGCGGCGCCGCCGCGCCTCAGTCGACCCCGGCGGCCAGCCTC
GCCGACATGGACGACGACATTCCGTTCTAA
ATGGCCAGCGTCAATAAAGTCATCCTGGTGGGCAACCTGGGCCGCGACCCGGAGGTCCGTTACAGCCCAGACGGTGCGGC
CGTCTGCAACCTCTCCCTCGCGACGACGTTCAGTTGGAAAGACAAGGCCAGCGGCGAAAAGCGCGAAGAGACCGAATGGC
ACCGGGTCGTGTTGTACAGCCGCCTGGCGGAGATCGCCGGGGAGTACCTGAAGAAGGGCCGATCGGTCTACATCGAAGGC
CGACTCAAGACGCGCAAGTGGCAGGATAAAGACACCGGCGCAGACCGCTACAGCACTGAGATCATCGCAGACCAGATGCA
GATGCTGGGCGGTCGCGAAGAAGGCGGCAGCGGCGGCAGTGGATATGACGACGCGCCGCGCCAGCAGCGCGCGCCGGCGC
AACGCCAAGCGCCCCAACGCAACGAGTACGCGAACCAACGCGGCGCCGCCGCGCCTCAGTCGACCCCGGCGGCCAGCCTC
GCCGACATGGACGACGACATTCCGTTCTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Vibrio cholerae strain A1552 |
54.494 |
100 |
0.574 |
| ssb | Neisseria gonorrhoeae MS11 |
51.705 |
100 |
0.538 |
| ssb | Glaesserella parasuis strain SC1401 |
50.276 |
100 |
0.538 |
| ssb | Neisseria meningitidis MC58 |
51.136 |
100 |
0.533 |