Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssbA   Type   Machinery gene
Locus tag   V5F87_RS09100 Genome accession   NZ_CP145595
Coordinates   1869690..1870118 (-) Length   142 a.a.
NCBI ID   WP_338499895.1    Uniprot ID   -
Organism   Staphylococcus capitis strain kcgeb_sa     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1833948..1878997 1869690..1870118 within 0


Gene organization within MGE regions


Location: 1833948..1878997
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  V5F87_RS08850 (V5F87_08850) - 1833948..1834145 (-) 198 WP_023350503.1 hypothetical protein -
  V5F87_RS08855 (V5F87_08855) - 1835095..1835280 (-) 186 WP_037579389.1 XRE family transcriptional regulator -
  V5F87_RS08860 (V5F87_08860) - 1835282..1835392 (-) 111 WP_087671645.1 hypothetical protein -
  V5F87_RS08865 (V5F87_08865) - 1835764..1837227 (-) 1464 WP_338499829.1 SH3 domain-containing protein -
  V5F87_RS08870 (V5F87_08870) - 1837202..1837612 (-) 411 WP_002469936.1 phage holin -
  V5F87_RS08875 (V5F87_08875) - 1837643..1838176 (-) 534 WP_226859640.1 hypothetical protein -
  V5F87_RS08880 (V5F87_08880) - 1838176..1838682 (-) 507 WP_095323876.1 hypothetical protein -
  V5F87_RS08885 (V5F87_08885) - 1838723..1838869 (-) 147 WP_338499833.1 XkdX family protein -
  V5F87_RS08890 (V5F87_08890) - 1838862..1839206 (-) 345 WP_002469970.1 hypothetical protein -
  V5F87_RS08895 (V5F87_08895) - 1839218..1840876 (-) 1659 WP_338499836.1 BppU family phage baseplate upper protein -
  V5F87_RS08900 (V5F87_08900) - 1840929..1842155 (-) 1227 WP_255263170.1 N-acetylglucosaminidase -
  V5F87_RS08905 (V5F87_08905) - 1842780..1843016 (-) 237 Protein_1718 CHAP domain-containing protein -
  V5F87_RS08910 (V5F87_08910) - 1843331..1843462 (-) 132 WP_255263171.1 hypothetical protein -
  V5F87_RS08915 (V5F87_08915) - 1843516..1843914 (-) 399 WP_002469999.1 hypothetical protein -
  V5F87_RS08920 (V5F87_08920) - 1843895..1844317 (-) 423 WP_338499839.1 hypothetical protein -
  V5F87_RS08925 (V5F87_08925) - 1844331..1845518 (-) 1188 WP_338499841.1 BppU family phage baseplate upper protein -
  V5F87_RS08930 (V5F87_08930) - 1845531..1847417 (-) 1887 WP_338499843.1 M14 family metallopeptidase -
  V5F87_RS08935 (V5F87_08935) - 1847420..1848880 (-) 1461 WP_193626002.1 phage tail protein -
  V5F87_RS08940 (V5F87_08940) - 1848892..1849848 (-) 957 WP_193626001.1 phage tail domain-containing protein -
  V5F87_RS08945 (V5F87_08945) - 1849860..1853657 (-) 3798 WP_338499848.1 phage tail protein -
  V5F87_RS08950 (V5F87_08950) - 1853672..1854016 (-) 345 WP_338499850.1 hypothetical protein -
  V5F87_RS08955 (V5F87_08955) - 1854058..1854417 (-) 360 WP_098905461.1 tail assembly chaperone -
  V5F87_RS08960 (V5F87_08960) - 1854479..1855033 (-) 555 WP_002436441.1 phage major tail protein, TP901-1 family -
  V5F87_RS08965 (V5F87_08965) - 1855080..1855469 (-) 390 WP_338499853.1 hypothetical protein -
  V5F87_RS08970 (V5F87_08970) - 1855469..1855831 (-) 363 WP_338499854.1 HK97-gp10 family putative phage morphogenesis protein -
  V5F87_RS08975 (V5F87_08975) - 1855833..1856135 (-) 303 WP_338499857.1 hypothetical protein -
  V5F87_RS08980 (V5F87_08980) - 1856132..1856461 (-) 330 WP_002436519.1 phage head-tail connector protein -
  V5F87_RS08985 (V5F87_08985) - 1856463..1856732 (-) 270 WP_338499859.1 hypothetical protein -
  V5F87_RS08990 (V5F87_08990) - 1856755..1857669 (-) 915 WP_338499861.1 phage major capsid protein -
  V5F87_RS08995 (V5F87_08995) - 1857687..1858292 (-) 606 WP_338499862.1 DUF4355 domain-containing protein -
  V5F87_RS09000 (V5F87_09000) - 1858547..1858690 (-) 144 WP_002436512.1 hypothetical protein -
  V5F87_RS09005 (V5F87_09005) - 1858683..1859228 (-) 546 WP_338499864.1 hypothetical protein -
  V5F87_RS09010 (V5F87_09010) - 1859248..1860198 (-) 951 WP_338499866.1 minor capsid protein -
  V5F87_RS09015 (V5F87_09015) - 1860205..1861701 (-) 1497 WP_338499869.1 phage portal protein -
  V5F87_RS09020 (V5F87_09020) - 1861715..1862995 (-) 1281 WP_338499870.1 PBSX family phage terminase large subunit -
  V5F87_RS09025 (V5F87_09025) - 1862982..1863410 (-) 429 WP_141489366.1 helix-turn-helix domain-containing protein -
  V5F87_RS09030 (V5F87_09030) - 1863633..1864049 (-) 417 WP_338499872.1 transcriptional regulator -
  V5F87_RS09035 (V5F87_09035) - 1864120..1864296 (-) 177 WP_338499874.1 transcriptional regulator -
  V5F87_RS09040 (V5F87_09040) - 1864345..1864662 (-) 318 WP_338500390.1 MazG-like family protein -
  V5F87_RS09045 (V5F87_09045) - 1864851..1865033 (-) 183 WP_193625992.1 hypothetical protein -
  V5F87_RS09050 (V5F87_09050) - 1865038..1865418 (-) 381 WP_338499877.1 SA1788 family PVL leukocidin-associated protein -
  V5F87_RS09055 (V5F87_09055) - 1865421..1865606 (-) 186 WP_338499878.1 hypothetical protein -
  V5F87_RS09060 (V5F87_09060) - 1865596..1866003 (-) 408 WP_234752166.1 DUF1064 domain-containing protein -
  V5F87_RS09065 (V5F87_09065) - 1866012..1866257 (-) 246 WP_338499882.1 DUF3269 family protein -
  V5F87_RS09070 (V5F87_09070) - 1866260..1866415 (-) 156 WP_168995397.1 hypothetical protein -
  V5F87_RS09075 (V5F87_09075) - 1866409..1867179 (-) 771 WP_325957245.1 ATP-binding protein -
  V5F87_RS09080 (V5F87_09080) - 1867192..1867935 (-) 744 WP_338499888.1 replication protein -
  V5F87_RS09085 (V5F87_09085) - 1867928..1868464 (-) 537 WP_338499889.1 hypothetical protein -
  V5F87_RS09090 (V5F87_09090) - 1868454..1869128 (-) 675 WP_338499891.1 putative HNHc nuclease -
  V5F87_RS09095 (V5F87_09095) - 1869129..1869677 (-) 549 WP_285109377.1 NUMOD4 motif-containing HNH endonuclease -
  V5F87_RS09100 (V5F87_09100) ssbA 1869690..1870118 (-) 429 WP_338499895.1 single-stranded DNA-binding protein Machinery gene
  V5F87_RS09105 (V5F87_09105) - 1870115..1870753 (-) 639 WP_338499898.1 ERF family protein -
  V5F87_RS09110 (V5F87_09110) - 1870746..1870967 (-) 222 WP_141489376.1 DUF2483 family protein -
  V5F87_RS09115 (V5F87_09115) - 1870933..1871215 (-) 283 Protein_1760 chordopoxvirus fusion protein -
  V5F87_RS09120 (V5F87_09120) - 1871237..1871449 (-) 213 WP_141489380.1 hypothetical protein -
  V5F87_RS09125 (V5F87_09125) - 1871589..1872053 (+) 465 WP_141489381.1 hypothetical protein -
  V5F87_RS09130 (V5F87_09130) - 1872137..1872301 (-) 165 WP_329503225.1 hypothetical protein -
  V5F87_RS09135 (V5F87_09135) - 1872315..1872527 (-) 213 WP_002436465.1 DUF771 domain-containing protein -
  V5F87_RS09140 (V5F87_09140) - 1872531..1872698 (-) 168 WP_338499904.1 hypothetical protein -
  V5F87_RS09145 (V5F87_09145) - 1872800..1872994 (-) 195 WP_141489384.1 hypothetical protein -
  V5F87_RS09150 (V5F87_09150) - 1873074..1873841 (-) 768 WP_338499907.1 DUF6551 family protein -
  V5F87_RS09155 (V5F87_09155) - 1873841..1874704 (-) 864 WP_338499909.1 ParB N-terminal domain-containing protein -
  V5F87_RS09160 (V5F87_09160) - 1874720..1874935 (-) 216 WP_237628625.1 XRE family transcriptional regulator -
  V5F87_RS09165 (V5F87_09165) - 1875133..1875744 (+) 612 WP_338499913.1 LexA family transcriptional regulator -
  V5F87_RS09170 (V5F87_09170) - 1876003..1876239 (+) 237 WP_338500391.1 hypothetical protein -
  V5F87_RS09175 (V5F87_09175) - 1876260..1877036 (+) 777 WP_338499915.1 DUF1828 domain-containing protein -
  V5F87_RS09180 (V5F87_09180) - 1877199..1877411 (+) 213 WP_002436421.1 hypothetical protein -
  V5F87_RS09185 (V5F87_09185) - 1877936..1878997 (+) 1062 WP_338499917.1 tyrosine-type recombinase/integrase -

Sequence


Protein


Download         Length: 142 a.a.        Molecular weight: 15924.53 Da        Isoelectric Point: 5.2263

>NTDB_id=938942 V5F87_RS09100 WP_338499895.1 1869690..1870118(-) (ssbA) [Staphylococcus capitis strain kcgeb_sa]
MINRVVLVGRLTKDPNFNEGDVANAKFTLAVNRPFKNKNGEQEADFINVVAFRRQAENVNNYLSKGQLAGVDGRIQTRSY
EKDGQRVFVTEVVADSVQFLEPKNSNQQNNQPQQQRRQAPAGNNPFANDNGIDDIDDSTLPF

Nucleotide


Download         Length: 429 bp        

>NTDB_id=938942 V5F87_RS09100 WP_338499895.1 1869690..1870118(-) (ssbA) [Staphylococcus capitis strain kcgeb_sa]
ATGATAAACAGAGTAGTTTTAGTAGGTAGATTAACGAAAGATCCAAACTTTAATGAAGGCGATGTAGCGAATGCAAAATT
TACATTAGCAGTAAATAGACCGTTTAAAAACAAAAATGGCGAACAAGAGGCTGATTTTATAAACGTAGTAGCTTTCAGAC
GACAAGCAGAAAACGTAAATAATTATCTATCAAAAGGACAACTTGCCGGAGTAGACGGTCGTATTCAGACACGCAGCTAT
GAAAAAGATGGCCAACGTGTATTCGTAACGGAAGTTGTGGCTGACAGCGTTCAATTTTTAGAACCAAAGAATAGCAACCA
ACAAAACAACCAACCTCAACAACAACGAAGACAAGCACCAGCAGGAAATAATCCTTTTGCAAATGATAATGGTATCGATG
ATATAGACGATTCTACACTTCCTTTCTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssbA Bacillus subtilis subsp. subtilis str. 168

55.233

100

0.669

  ssb Latilactobacillus sakei subsp. sakei 23K

48.824

100

0.585

  ssbB Bacillus subtilis subsp. subtilis str. 168

56.604

74.648

0.423

  ssbB/cilA Streptococcus pneumoniae TIGR4

44.444

82.394

0.366