Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | V4Q78_RS02690 | Genome accession | NZ_CP144563 |
| Coordinates | 548361..548714 (-) | Length | 117 a.a. |
| NCBI ID | WP_002014678.1 | Uniprot ID | A0A0D5YEH0 |
| Organism | Acinetobacter baumannii strain AB5075 isolate grey variant | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 545995..580133 | 548361..548714 | within | 0 |
Gene organization within MGE regions
Location: 545995..580133
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| V4Q78_RS02670 (V4Q78_02670) | - | 545995..547062 (+) | 1068 | WP_000107855.1 | site-specific integrase | - |
| V4Q78_RS02675 (V4Q78_02675) | - | 547090..547386 (-) | 297 | WP_000218943.1 | hypothetical protein | - |
| V4Q78_RS02680 (V4Q78_02680) | - | 547383..547604 (-) | 222 | WP_000424605.1 | hypothetical protein | - |
| V4Q78_RS02685 (V4Q78_02685) | - | 547614..548351 (-) | 738 | WP_000125747.1 | 3'-5' exonuclease | - |
| V4Q78_RS02690 (V4Q78_02690) | ssb | 548361..548714 (-) | 354 | WP_002014678.1 | single-stranded DNA-binding protein | Machinery gene |
| V4Q78_RS02695 (V4Q78_02695) | - | 548702..549019 (-) | 318 | WP_000049658.1 | hypothetical protein | - |
| V4Q78_RS02700 (V4Q78_02700) | - | 549012..549182 (-) | 171 | WP_001015076.1 | hypothetical protein | - |
| V4Q78_RS02705 (V4Q78_02705) | - | 549172..549723 (-) | 552 | WP_001178668.1 | hypothetical protein | - |
| V4Q78_RS02710 (V4Q78_02710) | - | 549789..550121 (-) | 333 | WP_000632296.1 | hypothetical protein | - |
| V4Q78_RS02715 (V4Q78_02715) | - | 550118..552856 (-) | 2739 | WP_002014340.1 | toprim domain-containing protein | - |
| V4Q78_RS02720 (V4Q78_02720) | - | 552950..553141 (-) | 192 | WP_001043481.1 | hypothetical protein | - |
| V4Q78_RS02725 (V4Q78_02725) | - | 553234..553575 (+) | 342 | WP_000786719.1 | helix-turn-helix transcriptional regulator | - |
| V4Q78_RS02730 (V4Q78_02730) | - | 553620..553835 (-) | 216 | WP_000556351.1 | hypothetical protein | - |
| V4Q78_RS02735 (V4Q78_02735) | - | 553960..554775 (-) | 816 | WP_001094886.1 | Rha family transcriptional regulator | - |
| V4Q78_RS02740 (V4Q78_02740) | - | 554883..555077 (-) | 195 | WP_000696053.1 | hypothetical protein | - |
| V4Q78_RS02745 (V4Q78_02745) | - | 555387..556265 (+) | 879 | WP_000417952.1 | BRCT domain-containing protein | - |
| V4Q78_RS02750 (V4Q78_02750) | - | 556265..556546 (+) | 282 | WP_000713873.1 | hypothetical protein | - |
| V4Q78_RS02755 (V4Q78_02755) | - | 556862..557062 (-) | 201 | WP_000130085.1 | TraR/DksA C4-type zinc finger protein | - |
| V4Q78_RS02760 (V4Q78_02760) | - | 557059..557298 (-) | 240 | WP_000113725.1 | ogr/Delta-like zinc finger family protein | - |
| V4Q78_RS02765 (V4Q78_02765) | - | 557428..558741 (-) | 1314 | WP_000483061.1 | contractile injection system protein, VgrG/Pvc8 family | - |
| V4Q78_RS02770 (V4Q78_02770) | - | 558742..559182 (-) | 441 | WP_000979757.1 | phage tail protein | - |
| V4Q78_RS02775 (V4Q78_02775) | - | 559188..561638 (-) | 2451 | WP_000774268.1 | phage tail tape measure protein | - |
| V4Q78_RS02785 (V4Q78_02785) | - | 562913..563734 (+) | 822 | WP_001046004.1 | OXA-23 family carbapenem-hydrolyzing class D beta-lactamase OXA-23 | - |
| V4Q78_RS02790 (V4Q78_02790) | - | 563839..564501 (-) | 663 | Protein_529 | ATP-binding protein | - |
| V4Q78_RS02795 (V4Q78_02795) | - | 564594..564935 (-) | 342 | WP_001071615.1 | phage tail assembly protein | - |
| V4Q78_RS02800 (V4Q78_02800) | - | 565002..565520 (-) | 519 | WP_001207612.1 | phage major tail tube protein | - |
| V4Q78_RS02805 (V4Q78_02805) | - | 565533..566708 (-) | 1176 | WP_000963361.1 | phage tail sheath protein | - |
| V4Q78_RS02810 (V4Q78_02810) | - | 566858..568810 (-) | 1953 | WP_000729646.1 | phage tail protein | - |
| V4Q78_RS02815 (V4Q78_02815) | - | 568822..569427 (-) | 606 | WP_001050805.1 | phage tail protein I | - |
| V4Q78_RS02820 (V4Q78_02820) | - | 569427..570329 (-) | 903 | WP_000109738.1 | baseplate J/gp47 family protein | - |
| V4Q78_RS02825 (V4Q78_02825) | - | 570326..570673 (-) | 348 | WP_000987745.1 | GPW/gp25 family protein | - |
| V4Q78_RS02830 (V4Q78_02830) | - | 570670..571302 (-) | 633 | WP_000990625.1 | phage baseplate assembly protein V | - |
| V4Q78_RS02835 (V4Q78_02835) | - | 571375..571824 (-) | 450 | WP_001059843.1 | phage virion morphogenesis protein | - |
| V4Q78_RS02840 (V4Q78_02840) | - | 571821..572348 (-) | 528 | WP_000742888.1 | phage tail protein | - |
| V4Q78_RS02845 (V4Q78_02845) | - | 572345..573175 (-) | 831 | WP_000600982.1 | N-acetylmuramidase family protein | - |
| V4Q78_RS02850 (V4Q78_02850) | - | 573172..573441 (-) | 270 | WP_000571491.1 | phage holin family protein | - |
| V4Q78_RS02855 (V4Q78_02855) | - | 573438..573788 (-) | 351 | WP_001114936.1 | putative holin | - |
| V4Q78_RS02860 (V4Q78_02860) | - | 573797..574006 (-) | 210 | WP_000659474.1 | tail protein X | - |
| V4Q78_RS02865 (V4Q78_02865) | - | 574007..574459 (-) | 453 | WP_000015691.1 | head completion/stabilization protein | - |
| V4Q78_RS02870 (V4Q78_02870) | gpM | 574563..575309 (-) | 747 | WP_000950641.1 | phage terminase small subunit | - |
| V4Q78_RS02875 (V4Q78_02875) | - | 575320..576309 (-) | 990 | WP_001243259.1 | phage major capsid protein, P2 family | - |
| V4Q78_RS02880 (V4Q78_02880) | - | 576362..577189 (-) | 828 | WP_000748563.1 | GPO family capsid scaffolding protein | - |
| V4Q78_RS02885 (V4Q78_02885) | - | 577327..579135 (+) | 1809 | WP_000289874.1 | terminase family protein | - |
| V4Q78_RS02890 (V4Q78_02890) | - | 579135..580133 (+) | 999 | WP_001284079.1 | phage portal protein | - |
Sequence
Protein
Download Length: 117 a.a. Molecular weight: 13365.13 Da Isoelectric Point: 9.7939
>NTDB_id=934298 V4Q78_RS02690 WP_002014678.1 548361..548714(-) (ssb) [Acinetobacter baumannii strain AB5075 isolate grey variant]
MRGINKVILVGMLGANPIPKQFQNGGSYAQFSIATSEKYQDKRTGDWIENTEWHRIVAHNRLGEIACQFLKKGSKVYIEG
SLHTRKWTDQNNQERYVTEVRAITFQSLDSLPQANPV
MRGINKVILVGMLGANPIPKQFQNGGSYAQFSIATSEKYQDKRTGDWIENTEWHRIVAHNRLGEIACQFLKKGSKVYIEG
SLHTRKWTDQNNQERYVTEVRAITFQSLDSLPQANPV
Nucleotide
Download Length: 354 bp
>NTDB_id=934298 V4Q78_RS02690 WP_002014678.1 548361..548714(-) (ssb) [Acinetobacter baumannii strain AB5075 isolate grey variant]
ATGCGCGGAATAAATAAAGTGATCTTGGTTGGAATGCTTGGTGCTAACCCAATTCCTAAACAATTTCAAAACGGTGGCTC
CTATGCTCAGTTTTCAATTGCCACTTCAGAAAAATACCAGGACAAACGCACTGGAGATTGGATTGAAAATACTGAGTGGC
ATCGGATTGTGGCTCACAACCGCCTAGGTGAAATTGCCTGTCAATTTCTCAAAAAAGGTTCAAAAGTTTATATCGAAGGC
TCATTACATACCCGGAAATGGACTGACCAAAATAATCAAGAACGTTACGTAACTGAAGTTAGAGCCATTACATTTCAATC
GCTCGATAGCTTGCCACAAGCAAACCCGGTTTAA
ATGCGCGGAATAAATAAAGTGATCTTGGTTGGAATGCTTGGTGCTAACCCAATTCCTAAACAATTTCAAAACGGTGGCTC
CTATGCTCAGTTTTCAATTGCCACTTCAGAAAAATACCAGGACAAACGCACTGGAGATTGGATTGAAAATACTGAGTGGC
ATCGGATTGTGGCTCACAACCGCCTAGGTGAAATTGCCTGTCAATTTCTCAAAAAAGGTTCAAAAGTTTATATCGAAGGC
TCATTACATACCCGGAAATGGACTGACCAAAATAATCAAGAACGTTACGTAACTGAAGTTAGAGCCATTACATTTCAATC
GCTCGATAGCTTGCCACAAGCAAACCCGGTTTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Glaesserella parasuis strain SC1401 |
55.455 |
94.017 |
0.521 |
| ssb | Vibrio cholerae strain A1552 |
54.545 |
84.615 |
0.462 |
| ssb | Neisseria gonorrhoeae MS11 |
42.857 |
89.744 |
0.385 |
| ssb | Neisseria meningitidis MC58 |
42.857 |
89.744 |
0.385 |