Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | V4Q77_RS02690 | Genome accession | NZ_CP144559 |
| Coordinates | 548370..548723 (-) | Length | 117 a.a. |
| NCBI ID | WP_002014678.1 | Uniprot ID | A0A0D5YEH0 |
| Organism | Acinetobacter baumannii strain AB5075 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 546004..580142 | 548370..548723 | within | 0 |
Gene organization within MGE regions
Location: 546004..580142
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| V4Q77_RS02670 (V4Q77_02670) | - | 546004..547071 (+) | 1068 | WP_000107855.1 | site-specific integrase | - |
| V4Q77_RS02675 (V4Q77_02675) | - | 547099..547395 (-) | 297 | WP_000218943.1 | hypothetical protein | - |
| V4Q77_RS02680 (V4Q77_02680) | - | 547392..547613 (-) | 222 | WP_000424605.1 | hypothetical protein | - |
| V4Q77_RS02685 (V4Q77_02685) | - | 547623..548360 (-) | 738 | WP_000125747.1 | 3'-5' exonuclease | - |
| V4Q77_RS02690 (V4Q77_02690) | ssb | 548370..548723 (-) | 354 | WP_002014678.1 | single-stranded DNA-binding protein | Machinery gene |
| V4Q77_RS02695 (V4Q77_02695) | - | 548711..549028 (-) | 318 | WP_000049658.1 | hypothetical protein | - |
| V4Q77_RS02700 (V4Q77_02700) | - | 549021..549191 (-) | 171 | WP_001015076.1 | hypothetical protein | - |
| V4Q77_RS02705 (V4Q77_02705) | - | 549181..549732 (-) | 552 | WP_001178668.1 | hypothetical protein | - |
| V4Q77_RS02710 (V4Q77_02710) | - | 549798..550130 (-) | 333 | WP_000632296.1 | hypothetical protein | - |
| V4Q77_RS02715 (V4Q77_02715) | - | 550127..552865 (-) | 2739 | WP_002014340.1 | toprim domain-containing protein | - |
| V4Q77_RS02720 (V4Q77_02720) | - | 552959..553150 (-) | 192 | WP_001043481.1 | hypothetical protein | - |
| V4Q77_RS02725 (V4Q77_02725) | - | 553243..553584 (+) | 342 | WP_000786719.1 | helix-turn-helix transcriptional regulator | - |
| V4Q77_RS02730 (V4Q77_02730) | - | 553629..553844 (-) | 216 | WP_000556351.1 | hypothetical protein | - |
| V4Q77_RS02735 (V4Q77_02735) | - | 553969..554784 (-) | 816 | WP_001094886.1 | Rha family transcriptional regulator | - |
| V4Q77_RS02740 (V4Q77_02740) | - | 554892..555086 (-) | 195 | WP_000696053.1 | hypothetical protein | - |
| V4Q77_RS02745 (V4Q77_02745) | - | 555396..556274 (+) | 879 | WP_000417952.1 | BRCT domain-containing protein | - |
| V4Q77_RS02750 (V4Q77_02750) | - | 556274..556555 (+) | 282 | WP_000713873.1 | hypothetical protein | - |
| V4Q77_RS02755 (V4Q77_02755) | - | 556871..557071 (-) | 201 | WP_000130085.1 | TraR/DksA C4-type zinc finger protein | - |
| V4Q77_RS02760 (V4Q77_02760) | - | 557068..557307 (-) | 240 | WP_000113725.1 | ogr/Delta-like zinc finger family protein | - |
| V4Q77_RS02765 (V4Q77_02765) | - | 557437..558750 (-) | 1314 | WP_000483061.1 | contractile injection system protein, VgrG/Pvc8 family | - |
| V4Q77_RS02770 (V4Q77_02770) | - | 558751..559191 (-) | 441 | WP_000979757.1 | phage tail protein | - |
| V4Q77_RS02775 (V4Q77_02775) | - | 559197..561647 (-) | 2451 | WP_000774268.1 | phage tail tape measure protein | - |
| V4Q77_RS02785 (V4Q77_02785) | - | 562922..563743 (+) | 822 | WP_001046004.1 | OXA-23 family carbapenem-hydrolyzing class D beta-lactamase OXA-23 | - |
| V4Q77_RS02790 (V4Q77_02790) | - | 563848..564510 (-) | 663 | Protein_529 | ATP-binding protein | - |
| V4Q77_RS02795 (V4Q77_02795) | - | 564603..564944 (-) | 342 | WP_001071615.1 | phage tail assembly protein | - |
| V4Q77_RS02800 (V4Q77_02800) | - | 565011..565529 (-) | 519 | WP_001207612.1 | phage major tail tube protein | - |
| V4Q77_RS02805 (V4Q77_02805) | - | 565542..566717 (-) | 1176 | WP_000963361.1 | phage tail sheath protein | - |
| V4Q77_RS02810 (V4Q77_02810) | - | 566867..568819 (-) | 1953 | WP_000729646.1 | phage tail protein | - |
| V4Q77_RS02815 (V4Q77_02815) | - | 568831..569436 (-) | 606 | WP_001050805.1 | phage tail protein I | - |
| V4Q77_RS02820 (V4Q77_02820) | - | 569436..570338 (-) | 903 | WP_000109738.1 | baseplate J/gp47 family protein | - |
| V4Q77_RS02825 (V4Q77_02825) | - | 570335..570682 (-) | 348 | WP_000987745.1 | GPW/gp25 family protein | - |
| V4Q77_RS02830 (V4Q77_02830) | - | 570679..571311 (-) | 633 | WP_000990625.1 | phage baseplate assembly protein V | - |
| V4Q77_RS02835 (V4Q77_02835) | - | 571384..571833 (-) | 450 | WP_001059843.1 | phage virion morphogenesis protein | - |
| V4Q77_RS02840 (V4Q77_02840) | - | 571830..572357 (-) | 528 | WP_000742888.1 | phage tail protein | - |
| V4Q77_RS02845 (V4Q77_02845) | - | 572354..573184 (-) | 831 | WP_000600982.1 | N-acetylmuramidase family protein | - |
| V4Q77_RS02850 (V4Q77_02850) | - | 573181..573450 (-) | 270 | WP_000571491.1 | phage holin family protein | - |
| V4Q77_RS02855 (V4Q77_02855) | - | 573447..573797 (-) | 351 | WP_001114936.1 | putative holin | - |
| V4Q77_RS02860 (V4Q77_02860) | - | 573806..574015 (-) | 210 | WP_000659474.1 | tail protein X | - |
| V4Q77_RS02865 (V4Q77_02865) | - | 574016..574468 (-) | 453 | WP_000015691.1 | head completion/stabilization protein | - |
| V4Q77_RS02870 (V4Q77_02870) | gpM | 574572..575318 (-) | 747 | WP_000950641.1 | phage terminase small subunit | - |
| V4Q77_RS02875 (V4Q77_02875) | - | 575329..576318 (-) | 990 | WP_001243259.1 | phage major capsid protein, P2 family | - |
| V4Q77_RS02880 (V4Q77_02880) | - | 576371..577198 (-) | 828 | WP_000748563.1 | GPO family capsid scaffolding protein | - |
| V4Q77_RS02885 (V4Q77_02885) | - | 577336..579144 (+) | 1809 | WP_000289874.1 | terminase family protein | - |
| V4Q77_RS02890 (V4Q77_02890) | - | 579144..580142 (+) | 999 | WP_001284079.1 | phage portal protein | - |
Sequence
Protein
Download Length: 117 a.a. Molecular weight: 13365.13 Da Isoelectric Point: 9.7939
>NTDB_id=934251 V4Q77_RS02690 WP_002014678.1 548370..548723(-) (ssb) [Acinetobacter baumannii strain AB5075]
MRGINKVILVGMLGANPIPKQFQNGGSYAQFSIATSEKYQDKRTGDWIENTEWHRIVAHNRLGEIACQFLKKGSKVYIEG
SLHTRKWTDQNNQERYVTEVRAITFQSLDSLPQANPV
MRGINKVILVGMLGANPIPKQFQNGGSYAQFSIATSEKYQDKRTGDWIENTEWHRIVAHNRLGEIACQFLKKGSKVYIEG
SLHTRKWTDQNNQERYVTEVRAITFQSLDSLPQANPV
Nucleotide
Download Length: 354 bp
>NTDB_id=934251 V4Q77_RS02690 WP_002014678.1 548370..548723(-) (ssb) [Acinetobacter baumannii strain AB5075]
ATGCGCGGAATAAATAAAGTGATCTTGGTTGGAATGCTTGGTGCTAACCCAATTCCTAAACAATTTCAAAACGGTGGCTC
CTATGCTCAGTTTTCAATTGCCACTTCAGAAAAATACCAGGACAAACGCACTGGAGATTGGATTGAAAATACTGAGTGGC
ATCGGATTGTGGCTCACAACCGCCTAGGTGAAATTGCCTGTCAATTTCTCAAAAAAGGTTCAAAAGTTTATATCGAAGGC
TCATTACATACCCGGAAATGGACTGACCAAAATAATCAAGAACGTTACGTAACTGAAGTTAGAGCCATTACATTTCAATC
GCTCGATAGCTTGCCACAAGCAAACCCGGTTTAA
ATGCGCGGAATAAATAAAGTGATCTTGGTTGGAATGCTTGGTGCTAACCCAATTCCTAAACAATTTCAAAACGGTGGCTC
CTATGCTCAGTTTTCAATTGCCACTTCAGAAAAATACCAGGACAAACGCACTGGAGATTGGATTGAAAATACTGAGTGGC
ATCGGATTGTGGCTCACAACCGCCTAGGTGAAATTGCCTGTCAATTTCTCAAAAAAGGTTCAAAAGTTTATATCGAAGGC
TCATTACATACCCGGAAATGGACTGACCAAAATAATCAAGAACGTTACGTAACTGAAGTTAGAGCCATTACATTTCAATC
GCTCGATAGCTTGCCACAAGCAAACCCGGTTTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Glaesserella parasuis strain SC1401 |
55.455 |
94.017 |
0.521 |
| ssb | Vibrio cholerae strain A1552 |
54.545 |
84.615 |
0.462 |
| ssb | Neisseria gonorrhoeae MS11 |
42.857 |
89.744 |
0.385 |
| ssb | Neisseria meningitidis MC58 |
42.857 |
89.744 |
0.385 |