Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | V3O04_RS15185 | Genome accession | NZ_CP144242 |
| Coordinates | 3170352..3170705 (-) | Length | 117 a.a. |
| NCBI ID | WP_004738307.1 | Uniprot ID | - |
| Organism | Acinetobacter baumannii strain SRM3 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 3168879..3206798 | 3170352..3170705 | within | 0 |
Gene organization within MGE regions
Location: 3168879..3206798
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| V3O04_RS15175 (V3O04_15170) | - | 3168879..3170039 (-) | 1161 | WP_004738311.1 | tyrosine-type recombinase/integrase | - |
| V3O04_RS15180 (V3O04_15175) | - | 3170128..3170331 (-) | 204 | WP_004738309.1 | hypothetical protein | - |
| V3O04_RS15185 (V3O04_15180) | ssb | 3170352..3170705 (-) | 354 | WP_004738307.1 | single-stranded DNA-binding protein | Machinery gene |
| V3O04_RS15190 (V3O04_15185) | - | 3170693..3171010 (-) | 318 | WP_004738305.1 | hypothetical protein | - |
| V3O04_RS15195 (V3O04_15190) | - | 3171003..3171356 (-) | 354 | WP_004738303.1 | hypothetical protein | - |
| V3O04_RS15200 (V3O04_15195) | - | 3171360..3171878 (-) | 519 | WP_004738302.1 | hypothetical protein | - |
| V3O04_RS15205 (V3O04_15200) | - | 3171946..3172548 (-) | 603 | WP_004738299.1 | hypothetical protein | - |
| V3O04_RS15210 (V3O04_15205) | - | 3172565..3175291 (-) | 2727 | WP_004738296.1 | toprim domain-containing protein | - |
| V3O04_RS15215 (V3O04_15210) | - | 3175301..3175471 (-) | 171 | WP_004738295.1 | hypothetical protein | - |
| V3O04_RS15220 (V3O04_15215) | - | 3175486..3175725 (-) | 240 | WP_004738293.1 | hypothetical protein | - |
| V3O04_RS15225 (V3O04_15220) | - | 3175728..3175928 (-) | 201 | WP_004738291.1 | hypothetical protein | - |
| V3O04_RS15230 (V3O04_15225) | - | 3176012..3176362 (+) | 351 | WP_004738288.1 | hypothetical protein | - |
| V3O04_RS15235 (V3O04_15230) | - | 3176359..3176937 (-) | 579 | WP_004738286.1 | hypothetical protein | - |
| V3O04_RS15240 (V3O04_15235) | - | 3176934..3177257 (-) | 324 | WP_004738284.1 | hypothetical protein | - |
| V3O04_RS15245 (V3O04_15240) | - | 3177673..3178680 (+) | 1008 | WP_004738282.1 | WYL domain-containing protein | - |
| V3O04_RS15250 (V3O04_15245) | - | 3178712..3179521 (+) | 810 | WP_004738281.1 | trypsin-like peptidase domain-containing protein | - |
| V3O04_RS15255 (V3O04_15250) | - | 3179854..3181086 (-) | 1233 | WP_004738280.1 | acyltransferase | - |
| V3O04_RS15260 (V3O04_15255) | - | 3181240..3181593 (-) | 354 | WP_004738279.1 | hypothetical protein | - |
| V3O04_RS15265 (V3O04_15260) | - | 3181598..3181993 (-) | 396 | WP_004738278.1 | hypothetical protein | - |
| V3O04_RS15270 (V3O04_15265) | - | 3181993..3182280 (-) | 288 | WP_004738277.1 | ogr/Delta-like zinc finger family protein | - |
| V3O04_RS15275 (V3O04_15270) | - | 3182559..3183350 (+) | 792 | WP_004738276.1 | DNA adenine methylase | - |
| V3O04_RS15280 (V3O04_15275) | - | 3183347..3184564 (-) | 1218 | WP_004738275.1 | contractile injection system protein, VgrG/Pvc8 family | - |
| V3O04_RS15285 (V3O04_15280) | - | 3184568..3184987 (-) | 420 | WP_004738274.1 | phage tail protein | - |
| V3O04_RS15290 (V3O04_15285) | - | 3185002..3188631 (-) | 3630 | WP_004738273.1 | hypothetical protein | - |
| V3O04_RS15295 (V3O04_15290) | - | 3188628..3188696 (-) | 69 | WP_238826551.1 | GpE family phage tail protein | - |
| V3O04_RS15300 (V3O04_15295) | - | 3188756..3189136 (-) | 381 | WP_196085662.1 | phage tail assembly protein | - |
| V3O04_RS15305 (V3O04_15300) | - | 3189198..3189713 (-) | 516 | WP_196085661.1 | phage major tail tube protein | - |
| V3O04_RS15310 (V3O04_15305) | - | 3189725..3190894 (-) | 1170 | WP_004738266.1 | phage tail sheath protein | - |
| V3O04_RS15315 (V3O04_15310) | - | 3191003..3191500 (-) | 498 | WP_196085660.1 | hypothetical protein | - |
| V3O04_RS15320 (V3O04_15315) | - | 3191502..3192248 (-) | 747 | WP_342713673.1 | hypothetical protein | - |
| V3O04_RS15325 (V3O04_15320) | - | 3192236..3193423 (-) | 1188 | WP_342713674.1 | hypothetical protein | - |
| V3O04_RS15330 (V3O04_15325) | - | 3193411..3194499 (-) | 1089 | WP_342713675.1 | phage tail protein | - |
| V3O04_RS15335 (V3O04_15330) | - | 3194500..3195036 (-) | 537 | WP_005112001.1 | phage tail protein I | - |
| V3O04_RS15340 (V3O04_15335) | - | 3195036..3195929 (-) | 894 | WP_254231394.1 | baseplate J/gp47 family protein | - |
| V3O04_RS15345 (V3O04_15340) | - | 3195950..3196306 (-) | 357 | WP_196085348.1 | GPW/gp25 family protein | - |
| V3O04_RS15350 (V3O04_15345) | - | 3196303..3196857 (-) | 555 | WP_196085347.1 | phage baseplate assembly protein V | - |
| V3O04_RS15355 (V3O04_15350) | - | 3196918..3197379 (-) | 462 | WP_032058820.1 | phage virion morphogenesis protein | - |
| V3O04_RS15360 (V3O04_15355) | - | 3197383..3197913 (-) | 531 | WP_005112011.1 | phage tail protein | - |
| V3O04_RS15365 (V3O04_15360) | - | 3197910..3198740 (-) | 831 | WP_156190991.1 | N-acetylmuramidase family protein | - |
| V3O04_RS15370 (V3O04_15365) | - | 3198737..3198994 (-) | 258 | WP_004738245.1 | phage holin family protein | - |
| V3O04_RS15375 (V3O04_15370) | - | 3198991..3199350 (-) | 360 | WP_004703727.1 | putative holin | - |
| V3O04_RS15380 (V3O04_15375) | - | 3199353..3199562 (-) | 210 | WP_004703729.1 | tail protein X | - |
| V3O04_RS15385 (V3O04_15380) | - | 3199559..3200008 (-) | 450 | WP_196085346.1 | head completion/stabilization protein | - |
| V3O04_RS15390 (V3O04_15385) | gpM | 3200109..3200873 (-) | 765 | WP_196085345.1 | phage terminase small subunit | - |
| V3O04_RS15395 (V3O04_15390) | - | 3200880..3201890 (-) | 1011 | WP_001247975.1 | phage major capsid protein, P2 family | - |
| V3O04_RS15400 (V3O04_15395) | - | 3201926..3202786 (-) | 861 | WP_196085344.1 | GPO family capsid scaffolding protein | - |
| V3O04_RS15405 (V3O04_15400) | - | 3202965..3204743 (+) | 1779 | WP_196085343.1 | terminase family protein | - |
| V3O04_RS15410 (V3O04_15405) | - | 3204740..3205786 (+) | 1047 | WP_254231395.1 | phage portal protein | - |
| V3O04_RS15415 (V3O04_15410) | - | 3205797..3206012 (+) | 216 | WP_227552920.1 | hypothetical protein | - |
| V3O04_RS15420 (V3O04_15415) | - | 3206120..3206299 (+) | 180 | WP_000009390.1 | type II toxin-antitoxin system HicA family toxin | - |
| V3O04_RS15425 (V3O04_15420) | - | 3206385..3206798 (+) | 414 | WP_032058837.1 | antitoxin | - |
Sequence
Protein
Download Length: 117 a.a. Molecular weight: 13204.83 Da Isoelectric Point: 9.8037
>NTDB_id=932853 V3O04_RS15185 WP_004738307.1 3170352..3170705(-) (ssb) [Acinetobacter baumannii strain SRM3]
MRGINKVILVGSLGANPITKHYPNGNTYVQFSIATSEKYQDKNTGEWIENTEWHRIIAYGRLGEVATQILKKGSKVYVEG
SLRTRQVTDQRGQQGYITEVRANTFQSLDSLPQANPY
MRGINKVILVGSLGANPITKHYPNGNTYVQFSIATSEKYQDKNTGEWIENTEWHRIIAYGRLGEVATQILKKGSKVYVEG
SLRTRQVTDQRGQQGYITEVRANTFQSLDSLPQANPY
Nucleotide
Download Length: 354 bp
>NTDB_id=932853 V3O04_RS15185 WP_004738307.1 3170352..3170705(-) (ssb) [Acinetobacter baumannii strain SRM3]
ATGCGCGGGATAAATAAAGTCATTCTTGTGGGAAGTTTAGGTGCAAATCCAATAACCAAACATTACCCGAACGGTAATAC
TTACGTTCAGTTTTCGATTGCTACTTCAGAAAAGTATCAAGATAAAAACACAGGTGAATGGATTGAGAATACGGAATGGC
ATCGAATTATTGCATACGGTCGATTAGGTGAGGTTGCCACTCAAATCTTAAAAAAAGGTTCAAAAGTTTATGTAGAGGGT
TCTTTACGAACAAGACAAGTTACCGACCAAAGAGGTCAGCAAGGTTATATAACCGAAGTAAGGGCAAACACCTTTCAGTC
TTTAGATAGCCTTCCGCAAGCAAACCCTTATTAA
ATGCGCGGGATAAATAAAGTCATTCTTGTGGGAAGTTTAGGTGCAAATCCAATAACCAAACATTACCCGAACGGTAATAC
TTACGTTCAGTTTTCGATTGCTACTTCAGAAAAGTATCAAGATAAAAACACAGGTGAATGGATTGAGAATACGGAATGGC
ATCGAATTATTGCATACGGTCGATTAGGTGAGGTTGCCACTCAAATCTTAAAAAAAGGTTCAAAAGTTTATGTAGAGGGT
TCTTTACGAACAAGACAAGTTACCGACCAAAGAGGTCAGCAAGGTTATATAACCGAAGTAAGGGCAAACACCTTTCAGTC
TTTAGATAGCCTTCCGCAAGCAAACCCTTATTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Glaesserella parasuis strain SC1401 |
54.545 |
94.017 |
0.513 |
| ssb | Vibrio cholerae strain A1552 |
54.545 |
84.615 |
0.462 |
| ssb | Neisseria gonorrhoeae MS11 |
42.857 |
89.744 |
0.385 |
| ssb | Neisseria meningitidis MC58 |
42.857 |
89.744 |
0.385 |