Detailed information NTG0931655

Bioinformatically predicted

Overview

• Name: ssb
• Type: Machinery gene
• Locus tag: V3C05_RS10520
• Genome accession: NZ_CP143878
• Coordinates: 2141649..2142098 (-)
• Length: 149 a.a.
• NCBI ID: WP_330962066.1
• Uniprot ID: -
• Organism: Pasteurella multocida subsp. multocida strain LH06
• Function: ssDNA binding (predicted from homology) DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type	MGE coordinates	Gene coordinates	Relative position	Distance (bp)
Prophage	2135323..2148957	2141649..2142098	within	0

Gene organization within MGE regions

Location: 2135323..2148957

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
V3C05_RS10465 (V3C05_10465)	-	2135323..2136375 (-)	1053	WP_250010829.1	tyrosine-type recombinase/integrase	-
V3C05_RS10470 (V3C05_10470)	-	2136285..2136617 (-)	333	WP_015691045.1	helix-turn-helix domain-containing protein	-
V3C05_RS10475 (V3C05_10475)	-	2136745..2137215 (-)	471	WP_015691046.1	hypothetical protein	-
V3C05_RS10480 (V3C05_10480)	-	2137219..2137515 (-)	297	WP_015691047.1	hypothetical protein	-
V3C05_RS10485 (V3C05_10485)	-	2137571..2138293 (-)	723	WP_005720319.1	phage antirepressor KilAC domain-containing protein	-
V3C05_RS10490 (V3C05_10490)	-	2138307..2138525 (-)	219	WP_005720317.1	hypothetical protein	-
V3C05_RS10495 (V3C05_10495)	-	2138784..2139137 (-)	354	WP_078802169.1	hypothetical protein	-
V3C05_RS10500 (V3C05_10500)	-	2139146..2139643 (-)	498	WP_014391445.1	DUF551 domain-containing protein	-
V3C05_RS10505 (V3C05_10505)	-	2139655..2140083 (-)	429	WP_078802170.1	DUF551 domain-containing protein	-
V3C05_RS10510 (V3C05_10510)	-	2140092..2140568 (-)	477	WP_078802171.1	hypothetical protein	-
V3C05_RS10515 (V3C05_10515)	rdgC	2140609..2141511 (-)	903	WP_014390699.1	recombination-associated protein RdgC	-
V3C05_RS10520 (V3C05_10520)	ssb	2141649..2142098 (-)	450	WP_330962066.1	single-stranded DNA-binding protein	Machinery gene
V3C05_RS10525 (V3C05_10525)	uvrA	2142270..2145101 (+)	2832	WP_330962067.1	excinuclease ABC subunit UvrA	-
V3C05_RS10530 (V3C05_10530)	sodC	2145172..2145732 (+)	561	WP_267174460.1	superoxide dismutase [Cu-Zn] SodC	-
V3C05_RS10535 (V3C05_10535)	rlmB	2145818..2146555 (-)	738	WP_005725044.1	23S rRNA (guanosine(2251)-2'-O)-methyltransferase RlmB	-
V3C05_RS10540 (V3C05_10540)	rnr	2146630..2148957 (-)	2328	WP_414058260.1	ribonuclease R	-

Sequence

Protein

• Length: 149 a.a.
• Molecular weight: 17062.85 Da
• Isoelectric Point: 5.3193

>NTDB_id=931655 V3C05_RS10520 WP_330962066.1 2141649..2142098(-) (ssb) [Pasteurella multocida subsp. multocida strain LH06]
MAGVNKVIIVGNLGNDPEIRTMPNGEAVANISVATSESWIDKNTNERREVTEWHRIVFYRRQAEVAGEYLRKGSKVYVEG
RLKTRKWQDQNGQDRYTTEIQGDVLQMLDSRQDSQQQQAQAPQNNAYANAKSGKPVQKFDNFEEDDIPF

Nucleotide

• Length: 450 bp

>NTDB_id=931655 V3C05_RS10520 WP_330962066.1 2141649..2142098(-) (ssb) [Pasteurella multocida subsp. multocida strain LH06]
ATGGCTGGAGTAAATAAAGTAATTATTGTAGGAAACTTAGGTAACGATCCTGAAATCCGCACAATGCCAAATGGTGAAGC
CGTAGCCAATATCAGCGTCGCGACCAGTGAAAGCTGGATCGACAAAAATACTAACGAACGTCGTGAAGTCACCGAATGGC
ATCGCATCGTATTCTACCGTCGCCAAGCTGAAGTGGCTGGGGAATATCTGCGTAAAGGTTCAAAAGTGTATGTAGAGGGA
CGCCTAAAAACCCGTAAATGGCAAGATCAAAATGGTCAAGACCGCTACACCACAGAGATTCAAGGCGACGTATTACAAAT
GCTAGACAGTCGCCAAGATTCACAGCAACAGCAAGCACAGGCACCACAAAATAATGCTTATGCGAATGCGAAAAGTGGAA
AACCAGTGCAGAAGTTTGATAATTTTGAAGAAGACGATATACCGTTTTGA

Domains

Predicted by InterproScan.

• Single-strand binding protein family (SSB) (4-108)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
ssb	Glaesserella parasuis strain SC1401	66.851	100	0.812
ssb	Vibrio cholerae strain A1552	58.273	93.289	0.544
ssb	Neisseria meningitidis MC58	41.808	100	0.497
ssb	Neisseria gonorrhoeae MS11	41.808	100	0.497