Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssb   Type   Machinery gene
Locus tag   V3C05_RS06335 Genome accession   NZ_CP143878
Coordinates   1347851..1348300 (-) Length   149 a.a.
NCBI ID   WP_266199913.1    Uniprot ID   -
Organism   Pasteurella multocida subsp. multocida strain LH06     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1344914..1393434 1347851..1348300 within 0


Gene organization within MGE regions


Location: 1344914..1393434
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  V3C05_RS06325 (V3C05_06325) - 1344914..1346434 (-) 1521 WP_010907418.1 site-specific integrase -
  V3C05_RS06330 (V3C05_06330) - 1346421..1347701 (-) 1281 WP_016533798.1 site-specific integrase -
  V3C05_RS06335 (V3C05_06335) ssb 1347851..1348300 (-) 450 WP_266199913.1 single-stranded DNA-binding protein Machinery gene
  V3C05_RS06340 (V3C05_06340) - 1348300..1348959 (-) 660 WP_041423209.1 translocation protein TolB precursor -
  V3C05_RS06345 (V3C05_06345) - 1348946..1349899 (-) 954 WP_014391451.1 recombinase RecT -
  V3C05_RS06350 (V3C05_06350) - 1349901..1350188 (-) 288 WP_014391452.1 hypothetical protein -
  V3C05_RS06355 (V3C05_06355) - 1350201..1350437 (-) 237 WP_330962019.1 hypothetical protein -
  V3C05_RS06360 (V3C05_06360) - 1350409..1350708 (-) 300 WP_078802174.1 hypothetical protein -
  V3C05_RS06365 (V3C05_06365) - 1350857..1351087 (+) 231 WP_223251317.1 hypothetical protein -
  V3C05_RS06370 (V3C05_06370) - 1351149..1351760 (-) 612 WP_330962020.1 KilA-N domain-containing protein -
  V3C05_RS06375 (V3C05_06375) - 1352034..1352576 (-) 543 WP_078737823.1 DUF4760 domain-containing protein -
  V3C05_RS06385 (V3C05_06385) - 1353309..1353503 (+) 195 WP_078737822.1 hypothetical protein -
  V3C05_RS06390 (V3C05_06390) - 1353484..1353654 (-) 171 WP_155295599.1 hypothetical protein -
  V3C05_RS06395 (V3C05_06395) - 1353667..1353897 (-) 231 WP_078737821.1 hypothetical protein -
  V3C05_RS06400 (V3C05_06400) - 1354356..1354670 (+) 315 WP_078819687.1 type II toxin-antitoxin system RelE/ParE family toxin -
  V3C05_RS06405 (V3C05_06405) - 1354667..1354957 (+) 291 WP_078819686.1 addiction module antidote protein -
  V3C05_RS06410 (V3C05_06410) - 1354984..1355421 (-) 438 WP_078819883.1 hypothetical protein -
  V3C05_RS06415 (V3C05_06415) - 1355418..1357262 (-) 1845 WP_071523830.1 DEAD/DEAH box helicase -
  V3C05_RS06420 (V3C05_06420) - 1357473..1358150 (-) 678 WP_014390718.1 XRE family transcriptional regulator -
  V3C05_RS06425 (V3C05_06425) - 1358274..1358471 (+) 198 WP_014390719.1 helix-turn-helix domain-containing protein -
  V3C05_RS06430 (V3C05_06430) - 1358521..1358982 (+) 462 WP_078802159.1 phage regulatory CII family protein -
  V3C05_RS06435 (V3C05_06435) - 1359043..1359726 (+) 684 WP_330962021.1 phage antirepressor KilAC domain-containing protein -
  V3C05_RS06440 (V3C05_06440) - 1359811..1360629 (+) 819 WP_015691057.1 hypothetical protein -
  V3C05_RS06445 (V3C05_06445) - 1360626..1361990 (+) 1365 WP_015691058.1 replicative DNA helicase -
  V3C05_RS06450 (V3C05_06450) - 1361987..1362526 (+) 540 WP_078802161.1 MT-A70 family methyltransferase -
  V3C05_RS06455 (V3C05_06455) - 1362536..1362886 (+) 351 WP_015691060.1 hypothetical protein -
  V3C05_RS06460 (V3C05_06460) - 1362908..1363414 (+) 507 WP_015691061.1 DUF1367 family protein -
  V3C05_RS06465 (V3C05_06465) - 1363499..1364149 (+) 651 WP_015691062.1 metallophosphoesterase -
  V3C05_RS06470 (V3C05_06470) - 1364223..1364438 (+) 216 WP_078801821.1 hypothetical protein -
  V3C05_RS06475 (V3C05_06475) - 1364431..1365033 (+) 603 WP_078801822.1 recombination protein NinG -
  V3C05_RS06480 (V3C05_06480) - 1365035..1365496 (+) 462 WP_014391474.1 antiterminator Q family protein -
  V3C05_RS06490 (V3C05_06490) - 1365823..1366083 (+) 261 WP_014391475.1 HP1 family phage holin -
  V3C05_RS06495 (V3C05_06495) - 1366080..1366610 (+) 531 WP_078737811.1 lysozyme -
  V3C05_RS06500 (V3C05_06500) - 1366583..1366906 (+) 324 WP_078801840.1 DUF2570 family protein -
  V3C05_RS06505 (V3C05_06505) - 1367128..1367562 (-) 435 WP_014390736.1 type II toxin-antitoxin system HicB family antitoxin -
  V3C05_RS06510 (V3C05_06510) - 1367591..1367773 (-) 183 WP_016533497.1 type II toxin-antitoxin system HicA family toxin -
  V3C05_RS06515 (V3C05_06515) - 1367856..1368353 (+) 498 WP_014390737.1 terminase -
  V3C05_RS06520 (V3C05_06520) - 1368337..1369572 (+) 1236 WP_064964918.1 PBSX family phage terminase large subunit -
  V3C05_RS06525 (V3C05_06525) - 1369582..1370985 (+) 1404 WP_078819653.1 DUF4055 domain-containing protein -
  V3C05_RS06530 (V3C05_06530) - 1370963..1372576 (+) 1614 WP_240958866.1 minor capsid protein -
  V3C05_RS06535 (V3C05_06535) - 1372579..1372797 (+) 219 WP_015691070.1 hypothetical protein -
  V3C05_RS06540 (V3C05_06540) - 1372772..1373206 (+) 435 WP_015691071.1 HD domain-containing protein -
  V3C05_RS06545 (V3C05_06545) - 1373246..1373413 (+) 168 WP_016533111.1 hypothetical protein -
  V3C05_RS06550 (V3C05_06550) - 1373541..1374326 (+) 786 WP_064964916.1 hypothetical protein -
  V3C05_RS06555 (V3C05_06555) - 1374344..1375501 (+) 1158 WP_078819654.1 P22 phage major capsid protein family protein -
  V3C05_RS06560 (V3C05_06560) - 1375558..1375794 (+) 237 WP_064964914.1 HeH/LEM domain-containing protein -
  V3C05_RS06565 (V3C05_06565) - 1375811..1376278 (+) 468 WP_078819655.1 DnaT-like ssDNA-binding protein -
  V3C05_RS06570 (V3C05_06570) - 1376280..1376654 (+) 375 WP_016533106.1 hypothetical protein -
  V3C05_RS06575 (V3C05_06575) - 1376656..1377057 (+) 402 WP_016533105.1 HK97 gp10 family phage protein -
  V3C05_RS06580 (V3C05_06580) - 1377057..1377449 (+) 393 WP_015691079.1 phage tail terminator-like protein -
  V3C05_RS06585 (V3C05_06585) - 1377462..1378478 (+) 1017 WP_078819656.1 phage tail tube protein -
  V3C05_RS06590 (V3C05_06590) - 1378552..1378956 (+) 405 WP_005756587.1 hypothetical protein -
  V3C05_RS06595 (V3C05_06595) - 1378965..1379294 (+) 330 WP_015691081.1 hypothetical protein -
  V3C05_RS06600 (V3C05_06600) - 1379302..1379628 (+) 327 WP_015691082.1 phage tail protein -
  V3C05_RS06605 (V3C05_06605) - 1379646..1382894 (+) 3249 WP_064964908.1 tape measure protein -
  V3C05_RS06610 (V3C05_06610) - 1382891..1383595 (+) 705 WP_078802163.1 phage minor tail protein L -
  V3C05_RS06615 (V3C05_06615) - 1383599..1384342 (+) 744 WP_016570177.1 C40 family peptidase -
  V3C05_RS06620 (V3C05_06620) - 1384285..1384908 (+) 624 WP_016570176.1 tail assembly protein -
  V3C05_RS06625 (V3C05_06625) - 1384912..1390812 (+) 5901 WP_330962022.1 phage tail protein -
  V3C05_RS06630 (V3C05_06630) - 1390860..1391183 (+) 324 WP_014667801.1 hypothetical protein -
  V3C05_RS06635 (V3C05_06635) - 1391609..1392445 (+) 837 WP_014390712.1 KilA-N domain-containing protein -
  V3C05_RS06640 (V3C05_06640) - 1392748..1393434 (+) 687 WP_227486347.1 KilA-N domain-containing protein -

Sequence


Protein


Download         Length: 149 a.a.        Molecular weight: 17024.90 Da        Isoelectric Point: 6.9835

>NTDB_id=931647 V3C05_RS06335 WP_266199913.1 1347851..1348300(-) (ssb) [Pasteurella multocida subsp. multocida strain LH06]
MAGVNRVIILGNLGSDPEIRTMPNGDPVAKISVATSESWIDKNTNERKTQTEWHSIVFYRRQAEICGQYLKKGSKVYVEG
KLRTRKWQDQNGQDRYTTEIQGDVLQMLDSRQDSQQQQAQAPQNNAYANAKSGKPVQKFDNFEEDDIPF

Nucleotide


Download         Length: 450 bp        

>NTDB_id=931647 V3C05_RS06335 WP_266199913.1 1347851..1348300(-) (ssb) [Pasteurella multocida subsp. multocida strain LH06]
ATGGCTGGGGTTAATCGTGTAATTATTTTAGGAAATTTAGGAAGCGATCCTGAAATCCGCACAATGCCAAATGGCGACCC
TGTGGCAAAAATCAGTGTGGCCACAAGTGAAAGCTGGATTGATAAAAACACAAACGAACGAAAAACACAAACTGAATGGC
ATTCTATCGTGTTCTATCGTCGCCAAGCAGAAATTTGCGGGCAGTATTTGAAGAAAGGCTCGAAAGTTTATGTGGAAGGT
AAGCTCAGAACACGCAAATGGCAAGATCAAAATGGTCAAGACCGCTACACCACAGAGATTCAAGGCGACGTATTACAAAT
GCTAGACAGTCGCCAAGATTCACAGCAACAGCAAGCACAGGCACCACAAAATAATGCTTATGCGAATGCGAAAAGTGGAA
AACCAGTGCAGAAGTTTGATAATTTTGAAGAAGACGATATACCGTTTTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Glaesserella parasuis strain SC1401

61.878

100

0.752

  ssb Vibrio cholerae strain A1552

52.518

93.289

0.49

  ssb Neisseria meningitidis MC58

39.548

100

0.47

  ssb Neisseria gonorrhoeae MS11

43.796

91.946

0.403