Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | sa230627_RS09990 | Genome accession | NZ_CP143800 |
| Coordinates | 2011402..2011872 (-) | Length | 156 a.a. |
| NCBI ID | WP_000934769.1 | Uniprot ID | - |
| Organism | Staphylococcus aureus strain sa230627barcode06 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1980401..2035007 | 2011402..2011872 | within | 0 |
Gene organization within MGE regions
Location: 1980401..2035007
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| sa230627_RS09765 (sa230627_1861) | scn | 1980401..1980751 (-) | 351 | WP_000702262.1 | complement inhibitor SCIN-A | - |
| sa230627_RS09770 (sa230627_1862) | - | 1981261..1981596 (-) | 336 | Protein_1886 | SH3 domain-containing protein | - |
| sa230627_RS09775 (sa230627_1863) | sak | 1982248..1982739 (-) | 492 | WP_000920041.1 | staphylokinase | - |
| sa230627_RS09780 (sa230627_1864) | - | 1982930..1983685 (-) | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
| sa230627_RS09785 (sa230627_1865) | - | 1983697..1983951 (-) | 255 | WP_000611512.1 | phage holin | - |
| sa230627_RS09790 | - | 1984003..1984110 (+) | 108 | WP_001791821.1 | hypothetical protein | - |
| sa230627_RS09795 | pepG1 | 1984163..1984297 (-) | 135 | WP_000880502.1 | type I toxin-antitoxin system toxin PepG1 | - |
| sa230627_RS09800 (sa230627_1866) | - | 1984482..1984856 (-) | 375 | WP_000340977.1 | hypothetical protein | - |
| sa230627_RS09805 (sa230627_1867) | - | 1984912..1985199 (-) | 288 | WP_001262620.1 | hypothetical protein | - |
| sa230627_RS09810 (sa230627_1868) | - | 1985245..1985397 (-) | 153 | WP_001000058.1 | hypothetical protein | - |
| sa230627_RS09815 (sa230627_1869) | - | 1985390..1989172 (-) | 3783 | WP_001836550.1 | phage tail spike protein | - |
| sa230627_RS09820 (sa230627_1870) | - | 1989188..1990679 (-) | 1492 | Protein_1896 | phage tail domain-containing protein | - |
| sa230627_RS09825 (sa230627_1872) | - | 1990679..1995327 (-) | 4649 | Protein_1897 | phage tail tape measure protein | - |
| sa230627_RS09830 | - | 1995383..1995505 (-) | 123 | WP_000570353.1 | hypothetical protein | - |
| sa230627_RS09835 (sa230627_1874) | - | 1995565..1996011 (-) | 447 | WP_000442601.1 | hypothetical protein | - |
| sa230627_RS09840 (sa230627_1875) | - | 1996076..1997029 (-) | 954 | WP_000570652.1 | major tail protein | - |
| sa230627_RS09845 (sa230627_1876) | - | 1997030..1997410 (-) | 381 | WP_000611452.1 | hypothetical protein | - |
| sa230627_RS09850 (sa230627_1877) | - | 1997407..1997784 (-) | 378 | Protein_1902 | HK97-gp10 family putative phage morphogenesis protein | - |
| sa230627_RS09855 (sa230627_1878) | - | 1997784..1998119 (-) | 336 | WP_000975314.1 | head-tail adaptor protein | - |
| sa230627_RS09860 (sa230627_1879) | - | 1998106..1998438 (-) | 333 | WP_001177483.1 | head-tail connector protein | - |
| sa230627_RS09865 (sa230627_1880) | - | 1998447..1998605 (-) | 159 | WP_001252099.1 | hypothetical protein | - |
| sa230627_RS09870 (sa230627_1881) | - | 1998641..1999888 (-) | 1248 | WP_000849950.1 | phage major capsid protein | - |
| sa230627_RS09875 (sa230627_1882) | - | 1999976..2000560 (-) | 585 | WP_000032525.1 | HK97 family phage prohead protease | - |
| sa230627_RS09880 (sa230627_1883) | - | 2000553..2001803 (-) | 1251 | WP_000511068.1 | phage portal protein | - |
| sa230627_RS09885 (sa230627_1884) | - | 2001809..2002009 (-) | 201 | WP_001836552.1 | hypothetical protein | - |
| sa230627_RS09890 (sa230627_1885) | - | 2002023..2003717 (-) | 1695 | WP_000133306.1 | phage terminase family protein | - |
| sa230627_RS09895 (sa230627_1886) | - | 2003720..2004187 (-) | 468 | WP_000919026.1 | phage terminase small subunit P27 family | - |
| sa230627_RS09900 (sa230627_1887) | - | 2004317..2004661 (-) | 345 | WP_000817289.1 | HNH endonuclease | - |
| sa230627_RS09905 (sa230627_1888) | - | 2004677..2005129 (-) | 453 | WP_000406187.1 | nucleoside triphosphate pyrophosphohydrolase family protein | - |
| sa230627_RS09910 (sa230627_1889) | - | 2005244..2005705 (-) | 462 | WP_000282753.1 | hypothetical protein | - |
| sa230627_RS09915 (sa230627_1890) | - | 2005728..2005928 (-) | 201 | WP_000265041.1 | DUF1514 family protein | - |
| sa230627_RS09920 (sa230627_1891) | - | 2005928..2006578 (-) | 651 | WP_001005262.1 | hypothetical protein | - |
| sa230627_RS09925 (sa230627_1893) | - | 2006737..2006886 (-) | 150 | WP_000595267.1 | hypothetical protein | - |
| sa230627_RS09930 (sa230627_1894) | - | 2006883..2007089 (-) | 207 | WP_000195810.1 | DUF1381 domain-containing protein | - |
| sa230627_RS09935 (sa230627_1895) | - | 2007126..2007662 (-) | 537 | WP_000185669.1 | dUTP diphosphatase | - |
| sa230627_RS09940 (sa230627_1896) | - | 2007655..2007903 (-) | 249 | WP_001065083.1 | DUF1024 family protein | - |
| sa230627_RS09945 (sa230627_1897) | - | 2007896..2008180 (-) | 285 | WP_001105621.1 | hypothetical protein | - |
| sa230627_RS09950 (sa230627_1898) | - | 2008177..2008626 (-) | 450 | WP_000982708.1 | YopX family protein | - |
| sa230627_RS09955 (sa230627_1899) | - | 2008623..2008817 (-) | 195 | WP_000983954.1 | hypothetical protein | - |
| sa230627_RS09960 (sa230627_1900) | - | 2008814..2009200 (-) | 387 | WP_000693615.1 | hypothetical protein | - |
| sa230627_RS09965 (sa230627_1901) | - | 2009214..2009456 (-) | 243 | WP_000131377.1 | phi PVL orf 51-like protein | - |
| sa230627_RS09970 (sa230627_1902) | - | 2009460..2009828 (-) | 369 | WP_000101270.1 | SA1788 family PVL leukocidin-associated protein | - |
| sa230627_RS09975 (sa230627_1903) | - | 2009841..2010245 (-) | 405 | WP_000401964.1 | RusA family crossover junction endodeoxyribonuclease | - |
| sa230627_RS09980 (sa230627_1904) | - | 2010254..2010472 (-) | 219 | WP_000338528.1 | hypothetical protein | - |
| sa230627_RS09985 (sa230627_1905) | - | 2010479..2011372 (-) | 894 | WP_000148324.1 | DnaD domain-containing protein | - |
| sa230627_RS09990 (sa230627_1906) | ssbA | 2011402..2011872 (-) | 471 | WP_000934769.1 | single-stranded DNA-binding protein | Machinery gene |
| sa230627_RS09995 (sa230627_1907) | - | 2011873..2012490 (-) | 618 | WP_071621397.1 | MBL fold metallo-hydrolase | - |
| sa230627_RS10000 (sa230627_1908) | - | 2012571..2013491 (-) | 921 | WP_000138481.1 | recombinase RecT | - |
| sa230627_RS10005 (sa230627_1909) | - | 2013493..2015448 (-) | 1956 | WP_001813910.1 | AAA family ATPase | - |
| sa230627_RS10010 (sa230627_1910) | - | 2015445..2015708 (-) | 264 | WP_001205732.1 | hypothetical protein | - |
| sa230627_RS10015 (sa230627_1911) | - | 2015717..2015977 (-) | 261 | WP_000291488.1 | DUF1108 family protein | - |
| sa230627_RS10020 (sa230627_1912) | - | 2016070..2016231 (-) | 162 | WP_000066020.1 | DUF1270 domain-containing protein | - |
| sa230627_RS10025 (sa230627_1913) | - | 2016228..2016548 (-) | 321 | WP_001815221.1 | DUF771 domain-containing protein | - |
| sa230627_RS10030 (sa230627_1914) | - | 2016607..2016834 (+) | 228 | WP_000801108.1 | hypothetical protein | - |
| sa230627_RS10035 (sa230627_1915) | - | 2016836..2017027 (-) | 192 | WP_000389906.1 | hypothetical protein | - |
| sa230627_RS10040 (sa230627_1916) | - | 2017077..2017433 (+) | 357 | WP_000768245.1 | DUF2513 domain-containing protein | - |
| sa230627_RS10045 (sa230627_1917) | - | 2017428..2017622 (-) | 195 | WP_001148859.1 | hypothetical protein | - |
| sa230627_RS10050 (sa230627_1918) | - | 2017638..2018426 (-) | 789 | WP_001148565.1 | phage antirepressor KilAC domain-containing protein | - |
| sa230627_RS10055 (sa230627_1919) | - | 2018442..2018684 (-) | 243 | WP_000639922.1 | DUF739 family protein | - |
| sa230627_RS10060 (sa230627_1920) | - | 2018848..2019564 (+) | 717 | WP_001083967.1 | LexA family transcriptional regulator | - |
| sa230627_RS10065 (sa230627_1921) | - | 2019576..2020433 (+) | 858 | WP_000804508.1 | HIRAN domain-containing protein | - |
| sa230627_RS10070 (sa230627_1922) | - | 2020478..2020660 (+) | 183 | WP_000705243.1 | hypothetical protein | - |
| sa230627_RS10075 (sa230627_1923) | - | 2020696..2020842 (+) | 147 | WP_001013104.1 | hypothetical protein | - |
| sa230627_RS10080 (sa230627_1924) | - | 2020839..2021453 (-) | 615 | WP_000191459.1 | hypothetical protein | - |
| sa230627_RS10085 (sa230627_1925) | - | 2021561..2022598 (+) | 1038 | WP_000857176.1 | site-specific integrase | - |
| sa230627_RS10090 (sa230627_1926) | sph | 2022649..2023479 (+) | 831 | Protein_1950 | sphingomyelin phosphodiesterase | - |
| sa230627_RS10095 (sa230627_1927) | lukG | 2023717..2024733 (-) | 1017 | WP_000595401.1 | bi-component leukocidin LukGH subunit G | - |
| sa230627_RS10100 (sa230627_1928) | lukH | 2024755..2025807 (-) | 1053 | WP_000791404.1 | bi-component leukocidin LukGH subunit H | - |
| sa230627_RS10105 (sa230627_1929) | - | 2026242..2027465 (+) | 1224 | WP_000206641.1 | ArgE/DapE family deacylase | - |
| sa230627_RS10110 (sa230627_1930) | - | 2027837..2028682 (-) | 846 | WP_031811354.1 | class I SAM-dependent methyltransferase | - |
| sa230627_RS10115 (sa230627_1931) | - | 2028744..2029655 (-) | 912 | WP_000825510.1 | iron-hydroxamate ABC transporter substrate-binding protein | - |
| sa230627_RS10120 (sa230627_1932) | - | 2029816..2031123 (+) | 1308 | WP_001045078.1 | TrkH family potassium uptake protein | - |
| sa230627_RS10125 (sa230627_1933) | - | 2031695..2032321 (-) | 627 | WP_000216894.1 | hypothetical protein | - |
| sa230627_RS10130 (sa230627_1934) | - | 2032318..2032497 (-) | 180 | WP_000201397.1 | hypothetical protein | - |
| sa230627_RS10135 (sa230627_1935) | groL | 2033031..2034647 (-) | 1617 | WP_000240645.1 | chaperonin GroEL | - |
| sa230627_RS10140 (sa230627_1936) | groES | 2034723..2035007 (-) | 285 | WP_000917289.1 | co-chaperone GroES | - |
Sequence
Protein
Download Length: 156 a.a. Molecular weight: 17671.55 Da Isoelectric Point: 5.2672
>NTDB_id=931473 sa230627_RS09990 WP_000934769.1 2011402..2011872(-) (ssbA) [Staphylococcus aureus strain sa230627barcode06]
MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLTGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIEIDDNDLPF
MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLTGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIEIDDNDLPF
Nucleotide
Download Length: 471 bp
>NTDB_id=931473 sa230627_RS09990 WP_000934769.1 2011402..2011872(-) (ssbA) [Staphylococcus aureus strain sa230627barcode06]
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGCACATTTACGAATGCACAAGGAGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGACGGGCGTAGATGGTAGGTTACAAACGCGG
AATTATGAAAATAAGGAAGGTCAACGTGTATATGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATACCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAAATAGATGACAATGATTTACCATTCTAA
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGCACATTTACGAATGCACAAGGAGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGACGGGCGTAGATGGTAGGTTACAAACGCGG
AATTATGAAAATAAGGAAGGTCAACGTGTATATGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATACCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAAATAGATGACAATGATTTACCATTCTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
55.367 |
100 |
0.628 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
50.588 |
100 |
0.551 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
59.434 |
67.949 |
0.404 |
| ssb | Glaesserella parasuis strain SC1401 |
32.203 |
100 |
0.365 |