Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   VP472_RS11905 Genome accession   NZ_CP143632
Coordinates   2460473..2460850 (-) Length   125 a.a.
NCBI ID   WP_094247734.1    Uniprot ID   -
Organism   Bacillus sp. MT(2024)     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2455473..2465850
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  VP472_RS11865 (VP472_11865) - 2455972..2456766 (+) 795 WP_014305407.1 YqhG family protein -
  VP472_RS11870 (VP472_11870) sinI 2456943..2457116 (+) 174 WP_003153105.1 anti-repressor SinI family protein Regulator
  VP472_RS11875 (VP472_11875) sinR 2457150..2457485 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  VP472_RS11880 (VP472_11880) - 2457533..2458318 (-) 786 WP_094247735.1 TasA family protein -
  VP472_RS11885 (VP472_11885) - 2458382..2458966 (-) 585 WP_012117977.1 signal peptidase I -
  VP472_RS11890 (VP472_11890) tapA 2458938..2459609 (-) 672 WP_070082109.1 amyloid fiber anchoring/assembly protein TapA -
  VP472_RS11895 (VP472_11895) - 2459868..2460197 (+) 330 WP_003153097.1 DUF3889 domain-containing protein -
  VP472_RS11900 (VP472_11900) - 2460237..2460416 (-) 180 WP_003153093.1 YqzE family protein -
  VP472_RS11905 (VP472_11905) comGG 2460473..2460850 (-) 378 WP_094247734.1 competence type IV pilus minor pilin ComGG Machinery gene
  VP472_RS11910 (VP472_11910) comGF 2460851..2461246 (-) 396 WP_094247733.1 competence type IV pilus minor pilin ComGF -
  VP472_RS11915 (VP472_11915) comGE 2461260..2461574 (-) 315 WP_015388003.1 competence type IV pilus minor pilin ComGE Machinery gene
  VP472_RS11920 (VP472_11920) comGD 2461558..2461995 (-) 438 WP_025852922.1 competence type IV pilus minor pilin ComGD Machinery gene
  VP472_RS11925 (VP472_11925) comGC 2461985..2462293 (-) 309 WP_003153087.1 competence type IV pilus major pilin ComGC Machinery gene
  VP472_RS11930 (VP472_11930) comGB 2462298..2463335 (-) 1038 WP_063174751.1 competence type IV pilus assembly protein ComGB Machinery gene
  VP472_RS11935 (VP472_11935) comGA 2463322..2464392 (-) 1071 WP_070082113.1 competence type IV pilus ATPase ComGA Machinery gene
  VP472_RS11940 (VP472_11940) - 2464584..2465534 (-) 951 WP_071391609.1 magnesium transporter CorA family protein -

Sequence

Protein


Download         Length: 125 a.a.        Molecular weight: 14125.06 Da        Isoelectric Point: 9.8061

>NTDB_id=930038 VP472_RS11905 WP_094247734.1 2460473..2460850(-) (comGG) [Bacillus sp. MT(2024)]
MHKSDGFIYPAVLFVSAAVLLVISYTSSDFITRKTFAKEAGEYWIGENLLQNGALLSSRHMTQGQKVQTGTQRFPYGTVS
FHITGSDRRETVQVTIQAETVSGTRREAHLLFDQKKKQLIQWTEV

Nucleotide


Download         Length: 378 bp        

>NTDB_id=930038 VP472_RS11905 WP_094247734.1 2460473..2460850(-) (comGG) [Bacillus sp. MT(2024)]
ATGCACAAATCTGACGGTTTTATCTATCCCGCGGTTCTGTTTGTTTCTGCCGCAGTTTTACTTGTCATCAGCTATACTTC
ATCTGATTTCATCACCCGAAAAACATTTGCGAAAGAGGCCGGGGAGTACTGGATCGGAGAGAATCTGCTCCAAAACGGCG
CGCTGCTGTCAAGCCGCCATATGACACAGGGACAAAAGGTCCAAACTGGTACACAGCGTTTTCCGTACGGAACTGTTTCC
TTCCACATCACCGGGAGTGATCGCCGGGAAACGGTTCAGGTTACAATTCAGGCCGAAACAGTGTCAGGCACGAGACGCGA
GGCTCACCTTTTGTTCGATCAGAAGAAGAAACAGCTGATTCAATGGACGGAAGTATAA

Domains

Predicted by InterproScan.

ComG operon protein 7 (ComGG)

(30-124)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

50.806

99.2

0.504