Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   VP472_RS11870 Genome accession   NZ_CP143632
Coordinates   2456943..2457116 (+) Length   57 a.a.
NCBI ID   WP_003153105.1    Uniprot ID   A7Z6M7
Organism   Bacillus sp. MT(2024)     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2451943..2462116
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  VP472_RS11855 (VP472_11855) gcvT 2452760..2453860 (-) 1101 WP_094247736.1 glycine cleavage system aminomethyltransferase GcvT -
  VP472_RS11860 (VP472_11860) - 2454284..2455954 (+) 1671 WP_128574830.1 SNF2-related protein -
  VP472_RS11865 (VP472_11865) - 2455972..2456766 (+) 795 WP_014305407.1 YqhG family protein -
  VP472_RS11870 (VP472_11870) sinI 2456943..2457116 (+) 174 WP_003153105.1 anti-repressor SinI family protein Regulator
  VP472_RS11875 (VP472_11875) sinR 2457150..2457485 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  VP472_RS11880 (VP472_11880) - 2457533..2458318 (-) 786 WP_094247735.1 TasA family protein -
  VP472_RS11885 (VP472_11885) - 2458382..2458966 (-) 585 WP_012117977.1 signal peptidase I -
  VP472_RS11890 (VP472_11890) tapA 2458938..2459609 (-) 672 WP_070082109.1 amyloid fiber anchoring/assembly protein TapA -
  VP472_RS11895 (VP472_11895) - 2459868..2460197 (+) 330 WP_003153097.1 DUF3889 domain-containing protein -
  VP472_RS11900 (VP472_11900) - 2460237..2460416 (-) 180 WP_003153093.1 YqzE family protein -
  VP472_RS11905 (VP472_11905) comGG 2460473..2460850 (-) 378 WP_094247734.1 competence type IV pilus minor pilin ComGG Machinery gene
  VP472_RS11910 (VP472_11910) comGF 2460851..2461246 (-) 396 WP_094247733.1 competence type IV pilus minor pilin ComGF -
  VP472_RS11915 (VP472_11915) comGE 2461260..2461574 (-) 315 WP_015388003.1 competence type IV pilus minor pilin ComGE Machinery gene
  VP472_RS11920 (VP472_11920) comGD 2461558..2461995 (-) 438 WP_025852922.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6695.72 Da        Isoelectric Point: 9.8170

>NTDB_id=930036 VP472_RS11870 WP_003153105.1 2456943..2457116(+) (sinI) [Bacillus sp. MT(2024)]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=930036 VP472_RS11870 WP_003153105.1 2456943..2457116(+) (sinI) [Bacillus sp. MT(2024)]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A7Z6M7

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

70.175

100

0.702