Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssb   Type   Machinery gene
Locus tag   V0I11_RS02730 Genome accession   NZ_CP143490
Coordinates   589797..590249 (-) Length   150 a.a.
NCBI ID   WP_330453955.1    Uniprot ID   -
Organism   Pasteurella multocida strain FCf147     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 584262..635626 589797..590249 within 0


Gene organization within MGE regions


Location: 584262..635626
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  V0I11_RS02670 (V0I11_02670) - 584262..584471 (+) 210 WP_330453937.1 cold-shock protein -
  V0I11_RS02675 (V0I11_02675) - 585014..585211 (-) 198 WP_014391107.1 helix-turn-helix transcriptional regulator -
  V0I11_RS02680 (V0I11_02680) - 585247..585564 (-) 318 WP_330453940.1 hypothetical protein -
  V0I11_RS02685 (V0I11_02685) - 585568..586068 (-) 501 WP_330453942.1 pyruvate kinase -
  V0I11_RS02690 (V0I11_02690) - 586072..586503 (-) 432 WP_330453944.1 hypothetical protein -
  V0I11_RS02695 (V0I11_02695) - 586506..586772 (-) 267 WP_330453945.1 hypothetical protein -
  V0I11_RS02700 (V0I11_02700) - 586815..587168 (-) 354 WP_014390697.1 hypothetical protein -
  V0I11_RS02705 (V0I11_02705) - 587177..587458 (-) 282 WP_330453948.1 DUF6378 domain-containing protein -
  V0I11_RS02710 (V0I11_02710) - 587455..587613 (-) 159 WP_330453949.1 hypothetical protein -
  V0I11_RS02715 (V0I11_02715) - 587610..588132 (-) 523 Protein_512 MazG-like family protein -
  V0I11_RS02720 (V0I11_02720) - 588432..589337 (-) 906 WP_330453951.1 prohibitin family protein -
  V0I11_RS02725 (V0I11_02725) - 589578..589787 (-) 210 WP_330453952.1 hypothetical protein -
  V0I11_RS02730 (V0I11_02730) ssb 589797..590249 (-) 453 WP_330453955.1 single-stranded DNA-binding protein Machinery gene
  V0I11_RS02735 (V0I11_02735) - 590249..590908 (-) 660 WP_330453957.1 translocation protein TolB precursor -
  V0I11_RS02740 (V0I11_02740) - 590895..591848 (-) 954 WP_330453958.1 recombinase RecT -
  V0I11_RS02745 (V0I11_02745) - 591850..592131 (-) 282 WP_330453960.1 hypothetical protein -
  V0I11_RS02750 (V0I11_02750) - 592373..592663 (-) 291 WP_330453962.1 hypothetical protein -
  V0I11_RS02755 (V0I11_02755) - 592749..593375 (-) 627 WP_330453965.1 Bro-N domain-containing protein -
  V0I11_RS02760 (V0I11_02760) - 593654..594157 (-) 504 WP_330453967.1 DUF4760 domain-containing protein -
  V0I11_RS02765 (V0I11_02765) - 594902..595438 (+) 537 WP_061406092.1 hypothetical protein -
  V0I11_RS02770 (V0I11_02770) - 595773..596318 (-) 546 WP_250251973.1 hypothetical protein -
  V0I11_RS02775 (V0I11_02775) - 596355..597317 (-) 963 WP_250251974.1 hypothetical protein -
  V0I11_RS02780 (V0I11_02780) - 597390..598079 (-) 690 WP_108574992.1 XRE family transcriptional regulator -
  V0I11_RS02785 (V0I11_02785) - 598207..598416 (+) 210 WP_005720263.1 helix-turn-helix transcriptional regulator -
  V0I11_RS02790 (V0I11_02790) - 598437..598712 (+) 276 WP_005756640.1 hypothetical protein -
  V0I11_RS02795 (V0I11_02795) - 598770..599471 (+) 702 WP_330453971.1 phage antirepressor KilAC domain-containing protein -
  V0I11_RS02800 (V0I11_02800) - 599468..600238 (+) 771 WP_330453972.1 helix-turn-helix domain-containing protein -
  V0I11_RS02805 (V0I11_02805) - 600238..600933 (+) 696 WP_330454234.1 replication protein P -
  V0I11_RS02810 (V0I11_02810) - 600926..601456 (+) 531 WP_272465511.1 MT-A70 family methyltransferase -
  V0I11_RS02815 (V0I11_02815) - 601465..601902 (+) 438 WP_064965060.1 DUF1367 family protein -
  V0I11_RS02820 (V0I11_02820) - 602062..602283 (+) 222 WP_330453973.1 hypothetical protein -
  V0I11_RS02825 (V0I11_02825) - 602270..602512 (+) 243 WP_330453974.1 hypothetical protein -
  V0I11_RS02830 (V0I11_02830) - 602509..602664 (+) 156 WP_155736201.1 hypothetical protein -
  V0I11_RS02835 (V0I11_02835) - 602876..603457 (+) 582 Protein_536 recombination protein NinG -
  V0I11_RS02840 (V0I11_02840) - 603454..603957 (+) 504 WP_330453977.1 antiterminator Q family protein -
  V0I11_RS02850 (V0I11_02850) - 604210..604575 (+) 366 WP_032854011.1 phage holin, lambda family -
  V0I11_RS02855 (V0I11_02855) - 604547..605131 (+) 585 WP_250251989.1 glycoside hydrolase family 19 protein -
  V0I11_RS02860 (V0I11_02860) - 605134..605457 (+) 324 WP_330453979.1 DUF2570 family protein -
  V0I11_RS02865 (V0I11_02865) - 605432..605644 (+) 213 WP_330454236.1 lytic protein Rz1 -
  V0I11_RS02870 (V0I11_02870) - 605675..606109 (-) 435 WP_046338366.1 type II toxin-antitoxin system HicB family antitoxin -
  V0I11_RS02875 (V0I11_02875) - 606138..606320 (-) 183 WP_330453982.1 type II toxin-antitoxin system HicA family toxin -
  V0I11_RS02880 (V0I11_02880) - 606636..607115 (+) 480 WP_115322756.1 DUF1441 family protein -
  V0I11_RS02885 (V0I11_02885) - 607115..609226 (+) 2112 WP_330453985.1 phage terminase large subunit family protein -
  V0I11_RS02890 (V0I11_02890) - 609223..609447 (+) 225 WP_330453987.1 hypothetical protein -
  V0I11_RS02895 (V0I11_02895) - 609530..609709 (+) 180 WP_330453988.1 hypothetical protein -
  V0I11_RS02900 (V0I11_02900) - 609721..611232 (+) 1512 WP_330453989.1 phage portal protein -
  V0I11_RS02905 (V0I11_02905) - 611282..611803 (+) 522 WP_330453990.1 phage antirepressor N-terminal domain-containing protein -
  V0I11_RS02910 (V0I11_02910) - 611835..612266 (-) 432 WP_330453991.1 hypothetical protein -
  V0I11_RS02915 (V0I11_02915) - 612534..613178 (+) 645 WP_330453992.1 KilA-N domain-containing protein -
  V0I11_RS02920 (V0I11_02920) - 613266..615242 (+) 1977 WP_330453993.1 ClpP-like prohead protease/major capsid protein fusion protein -
  V0I11_RS02925 (V0I11_02925) - 615309..615635 (+) 327 WP_330453995.1 DUF2190 family protein -
  V0I11_RS02930 (V0I11_02930) - 615628..615930 (+) 303 WP_330453996.1 phage tail protein -
  V0I11_RS02935 (V0I11_02935) - 615934..616461 (+) 528 WP_330453997.1 phage tail protein -
  V0I11_RS02940 (V0I11_02940) gpU 616461..616874 (+) 414 WP_330453998.1 phage tail terminator protein -
  V0I11_RS02945 (V0I11_02945) - 616871..617521 (+) 651 WP_330454001.1 hypothetical protein -
  V0I11_RS02950 (V0I11_02950) - 617576..617968 (+) 393 WP_250252012.1 hypothetical protein -
  V0I11_RS02955 (V0I11_02955) - 618037..618264 (+) 228 WP_083005723.1 DUF4035 domain-containing protein -
  V0I11_RS02960 (V0I11_02960) - 618528..619046 (+) 519 WP_330454004.1 phage antirepressor N-terminal domain-containing protein -
  V0I11_RS02965 (V0I11_02965) - 619193..619318 (+) 126 WP_265176396.1 hypothetical protein -
  V0I11_RS02970 (V0I11_02970) - 619324..619512 (+) 189 WP_330454007.1 hypothetical protein -
  V0I11_RS02975 (V0I11_02975) - 619515..620036 (+) 522 WP_330454008.1 hypothetical protein -
  V0I11_RS02980 (V0I11_02980) - 620199..621344 (+) 1146 WP_330454237.1 type I restriction endonuclease -
  V0I11_RS02985 (V0I11_02985) - 621476..621634 (+) 159 WP_159074444.1 hypothetical protein -
  V0I11_RS02990 (V0I11_02990) - 621950..622777 (+) 828 WP_330454011.1 phage antirepressor N-terminal domain-containing protein -
  V0I11_RS02995 (V0I11_02995) - 622832..623188 (+) 357 WP_250252024.1 DUF2513 domain-containing protein -
  V0I11_RS03000 (V0I11_03000) - 623247..623498 (+) 252 WP_330454016.1 hypothetical protein -
  V0I11_RS03005 (V0I11_03005) - 623615..626926 (+) 3312 WP_330454017.1 tape measure protein -
  V0I11_RS03010 (V0I11_03010) - 626923..627351 (+) 429 WP_330454018.1 phage tail protein -
  V0I11_RS03015 (V0I11_03015) - 627344..628147 (+) 804 WP_330454019.1 hypothetical protein -
  V0I11_RS03020 (V0I11_03020) - 628159..628743 (+) 585 WP_330454021.1 DUF4376 domain-containing protein -
  V0I11_RS03025 (V0I11_03025) - 628730..628996 (+) 267 WP_330454022.1 DNA helicase UvrD -
  V0I11_RS03030 (V0I11_03030) - 629005..629718 (+) 714 WP_250252030.1 phage minor tail protein L -
  V0I11_RS03035 (V0I11_03035) - 629721..630455 (+) 735 WP_330454025.1 C40 family peptidase -
  V0I11_RS03040 (V0I11_03040) - 630398..631021 (+) 624 WP_250252033.1 tail assembly protein -
  V0I11_RS03045 (V0I11_03045) - 631025..634366 (+) 3342 WP_330454027.1 host specificity protein J -
  V0I11_RS03050 (V0I11_03050) - 634385..635626 (-) 1242 WP_330454029.1 tyrosine-type recombinase/integrase -

Sequence


Protein


Download         Length: 150 a.a.        Molecular weight: 16944.82 Da        Isoelectric Point: 6.9832

>NTDB_id=929172 V0I11_RS02730 WP_330453955.1 589797..590249(-) (ssb) [Pasteurella multocida strain FCf147]
MAGVNKAIIVGNLGNDPEIRTMPNGDAVAKISVATSESWIDKNTNERKEVTEWHSIVFYRRQAEICGQYLKKGSKVYVEG
RLKTRKWQDQNGQDRYTTEIQGDVLQMLDSRQDSQPQQAQAPQNNAYANAKSGKPVQQQVGNFEEDNIPF

Nucleotide


Download         Length: 453 bp        

>NTDB_id=929172 V0I11_RS02730 WP_330453955.1 589797..590249(-) (ssb) [Pasteurella multocida strain FCf147]
ATGGCTGGAGTAAATAAAGCAATTATTGTCGGAAATTTAGGTAATGATCCTGAAATCCGCACAATGCCAAATGGCGACGC
AGTGGCAAAAATTAGTGTGGCCACGAGCGAAAGTTGGATTGACAAAAACACTAACGAACGAAAAGAAGTGACCGAGTGGC
ACTCTATTGTGTTTTATCGCCGCCAAGCAGAAATTTGCGGGCAGTATCTCAAGAAAGGCTCAAAAGTGTATGTAGAAGGT
CGTTTAAAAACTCGCAAATGGCAAGACCAAAACGGGCAAGACCGCTACACCACCGAAATCCAAGGCGACGTATTGCAGAT
GTTAGACAGTCGCCAAGATTCGCAACCACAGCAAGCACAGGCACCACAAAACAATGCTTATGCGAATGCGAAAAGTGGAA
AGCCTGTACAACAACAGGTAGGTAACTTTGAAGAGGATAATATCCCGTTTTAG


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Glaesserella parasuis strain SC1401

86.486

74

0.64

  ssb Vibrio cholerae strain A1552

53.957

92.667

0.5

  ssb Neisseria gonorrhoeae MS11

46.715

91.333

0.427

  ssb Neisseria meningitidis MC58

46.715

91.333

0.427