Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | V1228_RS13920 | Genome accession | NZ_CP143353 |
| Coordinates | 2991355..2991849 (+) | Length | 164 a.a. |
| NCBI ID | WP_159298390.1 | Uniprot ID | - |
| Organism | Proteus mirabilis strain 2023CK-01567 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2955771..2996933 | 2991355..2991849 | within | 0 |
Gene organization within MGE regions
Location: 2955771..2996933
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| V1228_RS13665 (V1228_13665) | - | 2955771..2957501 (-) | 1731 | WP_338310150.1 | phage head-binding domain-containing protein | - |
| V1228_RS13670 (V1228_13670) | - | 2957611..2957862 (+) | 252 | WP_152134463.1 | Arc family DNA-binding protein | - |
| V1228_RS13675 (V1228_13675) | - | 2957880..2958812 (+) | 933 | WP_250250006.1 | hypothetical protein | - |
| V1228_RS13680 (V1228_13680) | - | 2958835..2960847 (-) | 2013 | WP_338310151.1 | lytic transglycosylase domain-containing protein | - |
| V1228_RS13685 (V1228_13685) | - | 2960847..2962292 (-) | 1446 | WP_338310152.1 | phage DNA ejection protein | - |
| V1228_RS13690 (V1228_13690) | - | 2962302..2962961 (-) | 660 | WP_273799507.1 | DNA transfer protein | - |
| V1228_RS13695 (V1228_13695) | - | 2962955..2963416 (-) | 462 | WP_036976869.1 | DUF2824 family protein | - |
| V1228_RS13700 (V1228_13700) | - | 2963416..2964114 (-) | 699 | WP_338310153.1 | phage tail protein | - |
| V1228_RS13705 (V1228_13705) | - | 2964114..2965895 (-) | 1782 | WP_338310154.1 | packaged DNA stabilization protein | - |
| V1228_RS13710 (V1228_13710) | - | 2965867..2966364 (-) | 498 | WP_201704748.1 | packaged DNA stabilization gp4 family protein | - |
| V1228_RS13715 (V1228_13715) | - | 2966342..2966545 (-) | 204 | WP_088206643.1 | hypothetical protein | - |
| V1228_RS13720 (V1228_13720) | - | 2966598..2967881 (-) | 1284 | WP_088206644.1 | P22 phage major capsid protein family protein | - |
| V1228_RS13725 (V1228_13725) | - | 2967881..2968795 (-) | 915 | WP_102086762.1 | scaffolding protein | - |
| V1228_RS13730 (V1228_13730) | - | 2968810..2970900 (-) | 2091 | WP_338310155.1 | portal protein | - |
| V1228_RS13735 (V1228_13735) | - | 2970903..2972222 (-) | 1320 | WP_232466086.1 | terminase large subunit | - |
| V1228_RS13740 (V1228_13740) | - | 2972374..2972865 (-) | 492 | WP_036976889.1 | DNA-packaging protein | - |
| V1228_RS13745 (V1228_13745) | - | 2972874..2973233 (-) | 360 | WP_088206647.1 | hypothetical protein | - |
| V1228_RS13750 (V1228_13750) | - | 2973288..2973737 (-) | 450 | WP_261182133.1 | collagen-like protein | - |
| V1228_RS13755 (V1228_13755) | - | 2973747..2973971 (-) | 225 | WP_036977151.1 | DUF2560 family protein | - |
| V1228_RS13760 (V1228_13760) | - | 2974254..2974673 (-) | 420 | WP_152134477.1 | hypothetical protein | - |
| V1228_RS13765 (V1228_13765) | - | 2974670..2975119 (-) | 450 | WP_338310156.1 | lysis protein | - |
| V1228_RS13770 (V1228_13770) | - | 2975121..2975453 (-) | 333 | WP_036976899.1 | M15 family metallopeptidase | - |
| V1228_RS13775 (V1228_13775) | - | 2975440..2975733 (-) | 294 | WP_004918415.1 | phage holin family protein | - |
| V1228_RS13780 (V1228_13780) | - | 2975730..2976119 (-) | 390 | WP_004916901.1 | putative holin | - |
| V1228_RS13785 (V1228_13785) | - | 2976560..2977174 (-) | 615 | WP_109937974.1 | DUF1133 family protein | - |
| V1228_RS13790 (V1228_13790) | - | 2977386..2978006 (-) | 621 | WP_338310157.1 | recombination protein NinG | - |
| V1228_RS13795 (V1228_13795) | - | 2977993..2978121 (-) | 129 | WP_338310158.1 | hypothetical protein | - |
| V1228_RS13800 (V1228_13800) | - | 2978118..2978780 (-) | 663 | WP_104731782.1 | metallophosphoesterase | - |
| V1228_RS13805 (V1228_13805) | - | 2978923..2979366 (-) | 444 | WP_112842880.1 | recombination protein NinB | - |
| V1228_RS13810 (V1228_13810) | - | 2979368..2979577 (-) | 210 | WP_338310159.1 | hypothetical protein | - |
| V1228_RS13815 (V1228_13815) | - | 2979695..2979892 (-) | 198 | WP_151252778.1 | Lar family restriction alleviation protein | - |
| V1228_RS13820 (V1228_13820) | - | 2979986..2980243 (-) | 258 | WP_338310160.1 | DUF551 domain-containing protein | - |
| V1228_RS13825 (V1228_13825) | - | 2980230..2980451 (-) | 222 | WP_049216816.1 | hypothetical protein | - |
| V1228_RS13830 (V1228_13830) | - | 2980638..2982005 (-) | 1368 | WP_094960307.1 | replicative DNA helicase | - |
| V1228_RS13835 (V1228_13835) | - | 2982009..2982854 (-) | 846 | WP_094960305.1 | replication protein | - |
| V1228_RS13840 (V1228_13840) | - | 2982847..2983026 (-) | 180 | WP_049199128.1 | hypothetical protein | - |
| V1228_RS13845 (V1228_13845) | - | 2983019..2983195 (-) | 177 | WP_196573070.1 | hypothetical protein | - |
| V1228_RS13850 (V1228_13850) | - | 2983292..2983597 (-) | 306 | WP_338310161.1 | hypothetical protein | - |
| V1228_RS13855 (V1228_13855) | - | 2983805..2984014 (-) | 210 | WP_004245989.1 | helix-turn-helix transcriptional regulator | - |
| V1228_RS13860 (V1228_13860) | - | 2984097..2984780 (+) | 684 | WP_161729018.1 | LexA family transcriptional regulator | - |
| V1228_RS13865 (V1228_13865) | - | 2984867..2985784 (+) | 918 | WP_064497308.1 | serine dehydrogenasease | - |
| V1228_RS13870 (V1228_13870) | - | 2986379..2986699 (+) | 321 | WP_338310162.1 | hypothetical protein | - |
| V1228_RS13875 (V1228_13875) | - | 2986702..2987049 (+) | 348 | WP_338310163.1 | hypothetical protein | - |
| V1228_RS13880 (V1228_13880) | - | 2987107..2987382 (+) | 276 | WP_338310164.1 | hypothetical protein | - |
| V1228_RS13885 (V1228_13885) | - | 2987697..2988050 (+) | 354 | WP_080047887.1 | hypothetical protein | - |
| V1228_RS13890 (V1228_13890) | - | 2988160..2989056 (+) | 897 | WP_338310165.1 | cell envelope biogenesis protein TolA | - |
| V1228_RS13895 (V1228_13895) | - | 2989112..2989267 (+) | 156 | WP_338310166.1 | hypothetical protein | - |
| V1228_RS13900 (V1228_13900) | - | 2989275..2989529 (+) | 255 | WP_338310167.1 | hypothetical protein | - |
| V1228_RS13905 (V1228_13905) | - | 2989526..2989747 (+) | 222 | WP_110706707.1 | hypothetical protein | - |
| V1228_RS13910 (V1228_13910) | - | 2989744..2990670 (+) | 927 | WP_110706708.1 | RecT family recombinase | - |
| V1228_RS13915 (V1228_13915) | - | 2990670..2991365 (+) | 696 | WP_275348709.1 | lambda exonuclease family protein | - |
| V1228_RS13920 (V1228_13920) | ssb | 2991355..2991849 (+) | 495 | WP_159298390.1 | single-stranded DNA-binding protein | Machinery gene |
| V1228_RS13925 (V1228_13925) | - | 2991882..2992220 (+) | 339 | WP_004246003.1 | hypothetical protein | - |
| V1228_RS13930 (V1228_13930) | - | 2992454..2992774 (+) | 321 | WP_196560216.1 | hypothetical protein | - |
| V1228_RS13935 (V1228_13935) | - | 2992774..2993067 (+) | 294 | WP_110706711.1 | cyclic-phosphate processing receiver domain-containing protein | - |
| V1228_RS13940 (V1228_13940) | - | 2993134..2993247 (+) | 114 | WP_338310168.1 | hypothetical protein | - |
| V1228_RS13945 (V1228_13945) | - | 2993760..2994917 (+) | 1158 | WP_338310169.1 | site-specific integrase | - |
| V1228_RS13955 (V1228_13955) | folD | 2995206..2996078 (+) | 873 | WP_036970015.1 | bifunctional methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase FolD | - |
| V1228_RS13960 (V1228_13960) | ybcJ | 2996082..2996294 (+) | 213 | WP_004244244.1 | ribosome-associated protein YbcJ | - |
Sequence
Protein
Download Length: 164 a.a. Molecular weight: 18147.20 Da Isoelectric Point: 6.4674
>NTDB_id=928853 V1228_RS13920 WP_159298390.1 2991355..2991849(+) (ssb) [Proteus mirabilis strain 2023CK-01567]
MASKGVNKCILIGHLGQDPEIRYMPSGGAVANLTLATSESWRDKQTGEMKEKTEWHRVCIFGKLAEIAGEYLRKGSQVYI
EGQLQTRKWQDQSGQDRYSTEVVVNIGGTMQMLGGNGGNQVGSQKPQNQGWGKPQQPQAQKQASSNQAPQSEPPQDWDDQ
EIPF
MASKGVNKCILIGHLGQDPEIRYMPSGGAVANLTLATSESWRDKQTGEMKEKTEWHRVCIFGKLAEIAGEYLRKGSQVYI
EGQLQTRKWQDQSGQDRYSTEVVVNIGGTMQMLGGNGGNQVGSQKPQNQGWGKPQQPQAQKQASSNQAPQSEPPQDWDDQ
EIPF
Nucleotide
Download Length: 495 bp
>NTDB_id=928853 V1228_RS13920 WP_159298390.1 2991355..2991849(+) (ssb) [Proteus mirabilis strain 2023CK-01567]
ATGGCAAGTAAAGGCGTGAATAAATGTATTCTCATTGGTCACTTGGGGCAGGATCCAGAAATCCGCTATATGCCATCAGG
TGGCGCAGTAGCAAATCTCACACTAGCCACATCGGAATCGTGGCGTGATAAACAGACTGGTGAGATGAAGGAGAAAACCG
AGTGGCATCGCGTGTGCATCTTCGGGAAATTAGCAGAAATTGCAGGTGAATATCTGCGTAAAGGTTCACAAGTTTATATT
GAAGGTCAATTACAAACACGTAAATGGCAAGATCAAAGTGGTCAAGATCGCTACAGCACTGAAGTTGTGGTGAATATCGG
TGGCACAATGCAGATGTTAGGTGGTAACGGTGGTAATCAGGTAGGAAGCCAGAAACCACAGAATCAAGGATGGGGGAAAC
CTCAGCAACCGCAAGCACAAAAACAAGCATCGAGTAATCAAGCGCCGCAAAGTGAGCCGCCTCAAGATTGGGATGACCAA
GAAATACCCTTCTAA
ATGGCAAGTAAAGGCGTGAATAAATGTATTCTCATTGGTCACTTGGGGCAGGATCCAGAAATCCGCTATATGCCATCAGG
TGGCGCAGTAGCAAATCTCACACTAGCCACATCGGAATCGTGGCGTGATAAACAGACTGGTGAGATGAAGGAGAAAACCG
AGTGGCATCGCGTGTGCATCTTCGGGAAATTAGCAGAAATTGCAGGTGAATATCTGCGTAAAGGTTCACAAGTTTATATT
GAAGGTCAATTACAAACACGTAAATGGCAAGATCAAAGTGGTCAAGATCGCTACAGCACTGAAGTTGTGGTGAATATCGG
TGGCACAATGCAGATGTTAGGTGGTAACGGTGGTAATCAGGTAGGAAGCCAGAAACCACAGAATCAAGGATGGGGGAAAC
CTCAGCAACCGCAAGCACAAAAACAAGCATCGAGTAATCAAGCGCCGCAAAGTGAGCCGCCTCAAGATTGGGATGACCAA
GAAATACCCTTCTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Vibrio cholerae strain A1552 |
70.225 |
100 |
0.762 |
| ssb | Glaesserella parasuis strain SC1401 |
51.075 |
100 |
0.579 |
| ssb | Neisseria gonorrhoeae MS11 |
43.017 |
100 |
0.47 |
| ssb | Neisseria meningitidis MC58 |
43.017 |
100 |
0.47 |