Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | VSX74_RS03730 | Genome accession | NZ_CP142773 |
| Coordinates | 731843..732304 (+) | Length | 153 a.a. |
| NCBI ID | WP_329504017.1 | Uniprot ID | - |
| Organism | Pediococcus pentosaceus strain VHProbi M59 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 721527..760755 | 731843..732304 | within | 0 |
Gene organization within MGE regions
Location: 721527..760755
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| VSX74_RS03645 (VSX74_03645) | - | 721527..722699 (-) | 1173 | WP_329504007.1 | site-specific integrase | - |
| VSX74_RS03650 (VSX74_03650) | - | 723109..723633 (-) | 525 | WP_329504008.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
| VSX74_RS03655 (VSX74_03655) | - | 723648..724454 (-) | 807 | WP_329504009.1 | DUF3800 domain-containing protein | - |
| VSX74_RS03660 (VSX74_03660) | - | 724537..725001 (-) | 465 | WP_329504010.1 | hypothetical protein | - |
| VSX74_RS03665 (VSX74_03665) | - | 725061..725711 (-) | 651 | WP_329504011.1 | LexA family protein | - |
| VSX74_RS03670 (VSX74_03670) | - | 725854..726126 (+) | 273 | WP_198467876.1 | helix-turn-helix domain-containing protein | - |
| VSX74_RS03675 (VSX74_03675) | - | 726148..726294 (+) | 147 | WP_155266533.1 | hypothetical protein | - |
| VSX74_RS03680 (VSX74_03680) | - | 726291..726557 (-) | 267 | WP_029257886.1 | hypothetical protein | - |
| VSX74_RS03685 (VSX74_03685) | - | 726627..726875 (+) | 249 | WP_286121363.1 | hypothetical protein | - |
| VSX74_RS03690 (VSX74_03690) | - | 726962..727204 (+) | 243 | WP_329504012.1 | hypothetical protein | - |
| VSX74_RS03695 (VSX74_03695) | - | 727277..727744 (+) | 468 | WP_229573227.1 | helix-turn-helix domain-containing protein | - |
| VSX74_RS03700 (VSX74_03700) | - | 727745..728020 (+) | 276 | WP_286120505.1 | hypothetical protein | - |
| VSX74_RS03705 (VSX74_03705) | - | 728349..729242 (+) | 894 | WP_329504013.1 | DUF1351 domain-containing protein | - |
| VSX74_RS03710 (VSX74_03710) | - | 729242..730009 (+) | 768 | WP_159254603.1 | ERF family protein | - |
| VSX74_RS03715 (VSX74_03715) | - | 730019..730891 (+) | 873 | WP_329504014.1 | helix-turn-helix domain-containing protein | - |
| VSX74_RS03720 (VSX74_03720) | - | 730895..731596 (+) | 702 | WP_329504015.1 | putative HNHc nuclease | - |
| VSX74_RS03725 (VSX74_03725) | - | 731565..731825 (+) | 261 | WP_329504016.1 | hypothetical protein | - |
| VSX74_RS03730 (VSX74_03730) | ssb | 731843..732304 (+) | 462 | WP_329504017.1 | single-stranded DNA-binding protein | Machinery gene |
| VSX74_RS03735 (VSX74_03735) | - | 732315..732632 (+) | 318 | WP_251925142.1 | DeoR family transcriptional regulator | - |
| VSX74_RS03740 (VSX74_03740) | - | 732798..733160 (+) | 363 | WP_329504018.1 | hypothetical protein | - |
| VSX74_RS03745 (VSX74_03745) | - | 733160..733486 (+) | 327 | WP_329504019.1 | hypothetical protein | - |
| VSX74_RS03750 (VSX74_03750) | - | 733508..733705 (+) | 198 | WP_329504020.1 | DUF6877 family protein | - |
| VSX74_RS03755 (VSX74_03755) | - | 733902..734144 (+) | 243 | WP_251974456.1 | hypothetical protein | - |
| VSX74_RS03760 (VSX74_03760) | - | 734521..734952 (+) | 432 | WP_329504021.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| VSX74_RS03770 (VSX74_03770) | - | 735380..735907 (+) | 528 | WP_329504022.1 | super-infection exclusion protein B | - |
| VSX74_RS03775 (VSX74_03775) | - | 735894..736067 (+) | 174 | WP_329504023.1 | hypothetical protein | - |
| VSX74_RS03780 (VSX74_03780) | - | 736067..736567 (+) | 501 | WP_146419224.1 | terminase small subunit | - |
| VSX74_RS03785 (VSX74_03785) | - | 736564..737937 (+) | 1374 | WP_413232595.1 | PBSX family phage terminase large subunit | - |
| VSX74_RS03790 (VSX74_03790) | - | 737991..739487 (+) | 1497 | WP_329504024.1 | phage portal protein | - |
| VSX74_RS03795 (VSX74_03795) | - | 739484..740617 (+) | 1134 | WP_329504025.1 | phage minor capsid protein | - |
| VSX74_RS03800 (VSX74_03800) | - | 740717..741274 (+) | 558 | WP_329504026.1 | phage scaffolding protein | - |
| VSX74_RS03805 (VSX74_03805) | - | 741287..742189 (+) | 903 | WP_329504027.1 | hypothetical protein | - |
| VSX74_RS03810 (VSX74_03810) | - | 742257..742673 (+) | 417 | WP_329504028.1 | hypothetical protein | - |
| VSX74_RS03815 (VSX74_03815) | - | 742670..743017 (+) | 348 | WP_329504029.1 | putative minor capsid protein | - |
| VSX74_RS03820 (VSX74_03820) | - | 743017..743367 (+) | 351 | WP_329504030.1 | minor capsid protein | - |
| VSX74_RS03825 (VSX74_03825) | - | 743354..743749 (+) | 396 | WP_329504031.1 | minor capsid protein | - |
| VSX74_RS03830 (VSX74_03830) | - | 743753..744193 (+) | 441 | Protein_729 | phage tail tube protein | - |
| VSX74_RS03835 (VSX74_03835) | - | 744400..744837 (+) | 438 | WP_329504033.1 | hypothetical protein | - |
| VSX74_RS03840 (VSX74_03840) | - | 744844..745476 (+) | 633 | WP_329504034.1 | Gp15 family bacteriophage protein | - |
| VSX74_RS03845 (VSX74_03845) | - | 745480..750756 (+) | 5277 | WP_329504035.1 | tape measure protein | - |
| VSX74_RS03850 (VSX74_03850) | - | 750734..751606 (+) | 873 | WP_329504036.1 | phage tail domain-containing protein | - |
| VSX74_RS03855 (VSX74_03855) | - | 751615..752751 (+) | 1137 | WP_329504037.1 | phage tail protein | - |
| VSX74_RS03860 (VSX74_03860) | - | 752741..753067 (+) | 327 | WP_329504038.1 | hypothetical protein | - |
| VSX74_RS03865 (VSX74_03865) | - | 753057..753332 (+) | 276 | WP_329504039.1 | hypothetical protein | - |
| VSX74_RS03870 (VSX74_03870) | - | 753332..755149 (+) | 1818 | WP_329504040.1 | metallophosphoesterase | - |
| VSX74_RS03875 (VSX74_03875) | - | 755166..755930 (+) | 765 | WP_329504041.1 | hypothetical protein | - |
| VSX74_RS03880 (VSX74_03880) | - | 755940..756251 (+) | 312 | WP_329504042.1 | DUF2977 domain-containing protein | - |
| VSX74_RS03885 (VSX74_03885) | - | 756251..756397 (+) | 147 | WP_329504043.1 | XkdX family protein | - |
| VSX74_RS03890 (VSX74_03890) | - | 756441..756725 (+) | 285 | WP_329504044.1 | hypothetical protein | - |
| VSX74_RS03895 (VSX74_03895) | - | 756732..756971 (+) | 240 | WP_329504045.1 | phage holin | - |
| VSX74_RS03900 (VSX74_03900) | - | 756955..758085 (+) | 1131 | WP_329504046.1 | peptidoglycan recognition family protein | - |
| VSX74_RS03905 (VSX74_03905) | - | 759379..760755 (+) | 1377 | WP_201626886.1 | amino acid permease | - |
Sequence
Protein
Download Length: 153 a.a. Molecular weight: 16868.54 Da Isoelectric Point: 5.2253
>NTDB_id=926750 VSX74_RS03730 WP_329504017.1 731843..732304(+) (ssb) [Pediococcus pentosaceus strain VHProbi M59]
MINRTVLVGRLTNGPELKYTGSGVAVATFTVAVNRQFTNSQGEREADFIRCQMWRKAAENFCNFTHKGSLVGIDGRIQTR
SYENTEGTRIYVTEVVADRFSLLGSKPKSEAGTDEQGGQPSQNNNYQKPNSNPNDPFANGGQSIDINDDDLPF
MINRTVLVGRLTNGPELKYTGSGVAVATFTVAVNRQFTNSQGEREADFIRCQMWRKAAENFCNFTHKGSLVGIDGRIQTR
SYENTEGTRIYVTEVVADRFSLLGSKPKSEAGTDEQGGQPSQNNNYQKPNSNPNDPFANGGQSIDINDDDLPF
Nucleotide
Download Length: 462 bp
>NTDB_id=926750 VSX74_RS03730 WP_329504017.1 731843..732304(+) (ssb) [Pediococcus pentosaceus strain VHProbi M59]
ATGATTAATCGAACAGTATTAGTCGGGCGGTTAACTAACGGTCCAGAACTAAAATACACAGGCAGCGGTGTAGCAGTTGC
AACCTTCACAGTAGCCGTTAATCGGCAATTTACTAATTCGCAAGGCGAACGTGAAGCAGATTTTATTAGATGCCAAATGT
GGCGCAAAGCTGCTGAAAACTTCTGTAACTTTACTCACAAAGGTTCACTGGTTGGCATCGACGGACGCATTCAAACTCGT
TCATATGAGAACACAGAAGGCACTCGAATTTACGTAACCGAAGTAGTTGCTGATAGGTTTTCACTTTTGGGGAGCAAGCC
TAAGAGCGAAGCTGGTACGGACGAGCAGGGTGGCCAACCGAGCCAAAATAATAATTACCAAAAGCCGAATAGCAACCCTA
ATGATCCGTTTGCTAACGGTGGCCAAAGCATAGATATTAACGACGACGATTTACCGTTTTAG
ATGATTAATCGAACAGTATTAGTCGGGCGGTTAACTAACGGTCCAGAACTAAAATACACAGGCAGCGGTGTAGCAGTTGC
AACCTTCACAGTAGCCGTTAATCGGCAATTTACTAATTCGCAAGGCGAACGTGAAGCAGATTTTATTAGATGCCAAATGT
GGCGCAAAGCTGCTGAAAACTTCTGTAACTTTACTCACAAAGGTTCACTGGTTGGCATCGACGGACGCATTCAAACTCGT
TCATATGAGAACACAGAAGGCACTCGAATTTACGTAACCGAAGTAGTTGCTGATAGGTTTTCACTTTTGGGGAGCAAGCC
TAAGAGCGAAGCTGGTACGGACGAGCAGGGTGGCCAACCGAGCCAAAATAATAATTACCAAAAGCCGAATAGCAACCCTA
ATGATCCGTTTGCTAACGGTGGCCAAAGCATAGATATTAACGACGACGATTTACCGTTTTAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Latilactobacillus sakei subsp. sakei 23K |
57.647 |
100 |
0.641 |
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
51.163 |
100 |
0.575 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
56.25 |
73.203 |
0.412 |
| ssb | Neisseria gonorrhoeae MS11 |
32.37 |
100 |
0.366 |