Detailed information
Overview
| Name | comA | Type | Regulator |
| Locus tag | VUQ08_RS09375 | Genome accession | NZ_CP142433 |
| Coordinates | 1068602..1068697 (-) | Length | 31 a.a. |
| NCBI ID | WP_181452005.1 | Uniprot ID | - |
| Organism | Dolosigranulum savutiense strain MSK433 | ||
| Function | processing and transport of ComC (predicted from homology) Competence regulation |
||
Genomic Context
Location: 1063602..1073697
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| VUQ08_RS04905 (VUQ08_04910) | - | 1066136..1067281 (-) | 1146 | WP_077863083.1 | exonuclease SbcCD subunit D | - |
| VUQ08_RS04910 (VUQ08_04915) | - | 1067354..1068472 (-) | 1119 | WP_077863082.1 | hypothetical protein | - |
| VUQ08_RS09375 | comA | 1068602..1068697 (-) | 96 | WP_181452005.1 | cysteine peptidase family C39 domain-containing protein | Regulator |
| VUQ08_RS04915 (VUQ08_04920) | - | 1068797..1069024 (-) | 228 | WP_347299809.1 | hypothetical protein | - |
| VUQ08_RS09380 | - | 1069348..1069602 (-) | 255 | WP_371825535.1 | IS3 family transposase | - |
| VUQ08_RS04925 (VUQ08_04930) | - | 1069677..1070432 (-) | 756 | WP_004635227.1 | ATP-binding cassette domain-containing protein | - |
| VUQ08_RS04930 (VUQ08_04935) | - | 1070429..1071400 (-) | 972 | WP_347299810.1 | ABC transporter ATP-binding protein | - |
| VUQ08_RS04935 (VUQ08_04940) | - | 1071403..1072233 (-) | 831 | WP_111949638.1 | ABC transporter permease | - |
| VUQ08_RS04940 (VUQ08_04945) | - | 1072237..1073193 (-) | 957 | WP_208968192.1 | ABC transporter permease | - |
Sequence
Protein
Download Length: 31 a.a. Molecular weight: 3753.42 Da Isoelectric Point: 10.1043
>NTDB_id=925922 VUQ08_RS09375 WP_181452005.1 1068602..1068697(-) (comA) [Dolosigranulum savutiense strain MSK433]
MIFRKYKYRSQINEKDCGVAALGMILDNYRR
MIFRKYKYRSQINEKDCGVAALGMILDNYRR
Nucleotide
Download Length: 96 bp
>NTDB_id=925922 VUQ08_RS09375 WP_181452005.1 1068602..1068697(-) (comA) [Dolosigranulum savutiense strain MSK433]
GTGATTTTTAGAAAGTATAAATATAGATCTCAAATTAATGAAAAAGATTGCGGAGTTGCGGCTCTAGGTATGATTTTAGA
TAATTACAGAAGGTGA
GTGATTTTTAGAAAGTATAAATATAGATCTCAAATTAATGAAAAAGATTGCGGAGTTGCGGCTCTAGGTATGATTTTAGA
TAATTACAGAAGGTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comA | Streptococcus gordonii str. Challis substr. CH1 |
58.621 |
93.548 |
0.548 |
| comA | Streptococcus pneumoniae Rx1 |
48.276 |
93.548 |
0.452 |
| comA | Streptococcus pneumoniae D39 |
48.276 |
93.548 |
0.452 |
| comA | Streptococcus pneumoniae R6 |
48.276 |
93.548 |
0.452 |
| comA | Streptococcus mitis NCTC 12261 |
48.276 |
93.548 |
0.452 |
| comA | Streptococcus pneumoniae TIGR4 |
48.276 |
93.548 |
0.452 |
| comA | Streptococcus mitis SK321 |
48.276 |
93.548 |
0.452 |