Detailed information
Bioinformatically predicted
Overview
| Name | comGF | Type | Machinery gene |
| Locus tag | Llc71_RS11945 | Genome accession | NZ_AP025520 |
| Coordinates | 2332329..2332775 (-) | Length | 148 a.a. |
| NCBI ID | WP_011836043.1 | Uniprot ID | A0A1V0PET3 |
| Organism | Lactococcus cremoris strain 7-1 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| ICE | 2331488..2371171 | 2332329..2332775 | within | 0 |
Gene organization within MGE regions
Location: 2331488..2371171
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| Llc71_RS11935 (Llc71_23830) | - | 2331488..2331925 (-) | 438 | WP_011836041.1 | zinc-dependent MarR family transcriptional regulator | - |
| Llc71_RS11940 (Llc71_23840) | comGG | 2332006..2332305 (-) | 300 | WP_011836042.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| Llc71_RS11945 (Llc71_23860) | comGF | 2332329..2332775 (-) | 447 | WP_011836043.1 | competence type IV pilus minor pilin ComGF | Machinery gene |
| Llc71_RS11950 (Llc71_23870) | comGE | 2332738..2333034 (-) | 297 | WP_248536738.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| Llc71_RS11955 (Llc71_23880) | comGD | 2333006..2333437 (-) | 432 | WP_052719845.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
| Llc71_RS11960 (Llc71_23890) | comGC | 2333397..2333666 (-) | 270 | WP_042748573.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| Llc71_RS11970 (Llc71_23900) | - | 2334592..2335029 (-) | 438 | WP_248536995.1 | DUF2335 domain-containing protein | - |
| Llc71_RS11975 (Llc71_23910) | - | 2335019..2335246 (-) | 228 | WP_058225013.1 | hypothetical protein | - |
| Llc71_RS11980 (Llc71_23920) | - | 2335393..2336172 (-) | 780 | WP_248536739.1 | peptidoglycan amidohydrolase family protein | - |
| Llc71_RS11985 (Llc71_23930) | - | 2336172..2336459 (-) | 288 | WP_023164507.1 | phage holin | - |
| Llc71_RS11990 (Llc71_23940) | - | 2336471..2336821 (-) | 351 | WP_248536740.1 | hypothetical protein | - |
| Llc71_RS11995 (Llc71_23950) | - | 2336834..2337070 (-) | 237 | WP_248536741.1 | hypothetical protein | - |
| Llc71_RS12000 (Llc71_23960) | - | 2337082..2339643 (-) | 2562 | WP_248536742.1 | hypothetical protein | - |
| Llc71_RS12005 (Llc71_23970) | - | 2339644..2341359 (-) | 1716 | WP_248536743.1 | distal tail protein Dit | - |
| Llc71_RS12010 (Llc71_23980) | - | 2341359..2345771 (-) | 4413 | WP_248536744.1 | tape measure protein | - |
| Llc71_RS12015 (Llc71_23990) | - | 2345771..2346025 (-) | 255 | WP_101913605.1 | hypothetical protein | - |
| Llc71_RS12020 (Llc71_24000) | - | 2346130..2346504 (-) | 375 | WP_046781540.1 | tail assembly chaperone | - |
| Llc71_RS12025 (Llc71_24010) | - | 2346628..2347161 (-) | 534 | WP_248536745.1 | phage major tail protein, TP901-1 family | - |
| Llc71_RS12030 (Llc71_24020) | - | 2347176..2347550 (-) | 375 | WP_248536746.1 | hypothetical protein | - |
| Llc71_RS12035 (Llc71_24030) | - | 2347613..2347903 (-) | 291 | WP_248536747.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| Llc71_RS12040 (Llc71_24040) | - | 2347912..2348247 (-) | 336 | WP_248536748.1 | hypothetical protein | - |
| Llc71_RS12045 (Llc71_24050) | - | 2348244..2348576 (-) | 333 | WP_248536749.1 | phage head-tail connector protein | - |
| Llc71_RS12050 (Llc71_24060) | - | 2348563..2348760 (-) | 198 | WP_014570729.1 | HeH/LEM domain-containing protein | - |
| Llc71_RS12055 (Llc71_24070) | - | 2348760..2349581 (-) | 822 | WP_058207139.1 | N4-gp56 family major capsid protein | - |
| Llc71_RS12060 (Llc71_24080) | - | 2349583..2350245 (-) | 663 | WP_248536750.1 | DUF4355 domain-containing protein | - |
| Llc71_RS12065 (Llc71_24090) | - | 2350432..2350704 (+) | 273 | WP_011834801.1 | DUF3892 domain-containing protein | - |
| Llc71_RS12070 (Llc71_24100) | - | 2350701..2350859 (-) | 159 | WP_248536751.1 | hypothetical protein | - |
| Llc71_RS12075 (Llc71_24110) | - | 2350907..2351950 (-) | 1044 | WP_248536752.1 | minor capsid protein | - |
| Llc71_RS12080 (Llc71_24120) | - | 2351954..2353324 (-) | 1371 | WP_248536753.1 | phage portal protein | - |
| Llc71_RS12085 (Llc71_24130) | terL | 2353338..2354726 (-) | 1389 | WP_248536754.1 | phage terminase large subunit | - |
| Llc71_RS12090 (Llc71_24140) | - | 2354719..2355186 (-) | 468 | WP_248536755.1 | helix-turn-helix domain-containing protein | - |
| Llc71_RS12095 (Llc71_24150) | - | 2355612..2356034 (-) | 423 | WP_014570802.1 | RinA family protein | - |
| Llc71_RS12100 (Llc71_24160) | - | 2356111..2356419 (-) | 309 | WP_019292848.1 | hypothetical protein | - |
| Llc71_RS12105 (Llc71_24170) | - | 2356791..2356940 (+) | 150 | WP_248536610.1 | hypothetical protein | - |
| Llc71_RS12110 (Llc71_24190) | - | 2357192..2357518 (-) | 327 | WP_248536756.1 | hypothetical protein | - |
| Llc71_RS12115 (Llc71_24200) | - | 2357590..2358009 (-) | 420 | WP_248536757.1 | dUTP diphosphatase | - |
| Llc71_RS12120 (Llc71_24210) | - | 2358006..2358611 (-) | 606 | WP_248536758.1 | DUF1642 domain-containing protein | - |
| Llc71_RS12125 (Llc71_24220) | - | 2358604..2358810 (-) | 207 | WP_248536759.1 | DUF1125 domain-containing protein | - |
| Llc71_RS12130 (Llc71_24230) | - | 2358811..2359077 (-) | 267 | WP_248536760.1 | hypothetical protein | - |
| Llc71_RS12135 (Llc71_24240) | - | 2359058..2359252 (-) | 195 | WP_248536761.1 | hypothetical protein | - |
| Llc71_RS12140 (Llc71_24250) | - | 2359239..2359565 (-) | 327 | WP_248536762.1 | hypothetical protein | - |
| Llc71_RS12145 (Llc71_24260) | - | 2359580..2360104 (-) | 525 | WP_046782331.1 | hypothetical protein | - |
| Llc71_RS12150 (Llc71_24270) | - | 2360213..2360452 (-) | 240 | WP_248536996.1 | DUF1031 family protein | - |
| Llc71_RS12155 (Llc71_24280) | - | 2360465..2360854 (-) | 390 | WP_248536763.1 | RusA family crossover junction endodeoxyribonuclease | - |
| Llc71_RS12160 (Llc71_24290) | - | 2360851..2361576 (-) | 726 | WP_011676538.1 | hypothetical protein | - |
| Llc71_RS12165 (Llc71_24300) | - | 2361576..2362364 (-) | 789 | WP_248536764.1 | phage replisome organiser protein | - |
| Llc71_RS12170 (Llc71_24310) | - | 2362498..2363001 (-) | 504 | WP_011834781.1 | hypothetical protein | - |
| Llc71_RS12175 (Llc71_24320) | - | 2363001..2363720 (-) | 720 | WP_011834780.1 | AAA family ATPase | - |
| Llc71_RS12180 (Llc71_24330) | - | 2363729..2364247 (-) | 519 | WP_248536765.1 | host-nuclease inhibitor Gam family protein | - |
| Llc71_RS12185 (Llc71_24340) | - | 2364347..2364589 (-) | 243 | WP_248536766.1 | hypothetical protein | - |
| Llc71_RS12190 (Llc71_24350) | - | 2364591..2364791 (-) | 201 | WP_003132896.1 | helix-turn-helix transcriptional regulator | - |
| Llc71_RS12195 (Llc71_24360) | - | 2364828..2365043 (-) | 216 | WP_248536767.1 | hypothetical protein | - |
| Llc71_RS12200 (Llc71_24370) | - | 2365150..2365314 (+) | 165 | WP_248536768.1 | hypothetical protein | - |
| Llc71_RS12205 (Llc71_24380) | - | 2365311..2365529 (-) | 219 | WP_063282493.1 | hypothetical protein | - |
| Llc71_RS12210 (Llc71_24400) | - | 2365875..2366354 (-) | 480 | WP_248536769.1 | phage antirepressor KilAC domain-containing protein | - |
| Llc71_RS12215 (Llc71_24410) | - | 2366388..2366666 (-) | 279 | WP_248536770.1 | Bro-N domain-containing protein | - |
| Llc71_RS12220 (Llc71_24420) | - | 2366678..2366917 (-) | 240 | WP_023189646.1 | helix-turn-helix transcriptional regulator | - |
| Llc71_RS12225 (Llc71_24430) | - | 2367077..2367901 (+) | 825 | WP_248536771.1 | DUF4393 domain-containing protein | - |
| Llc71_RS12230 (Llc71_24440) | - | 2368324..2369211 (+) | 888 | WP_248536772.1 | S24 family peptidase | - |
| Llc71_RS12235 (Llc71_24450) | - | 2369269..2369592 (+) | 324 | WP_248536773.1 | hypothetical protein | - |
| Llc71_RS12240 (Llc71_24460) | - | 2369714..2371171 (+) | 1458 | WP_248536774.1 | recombinase family protein | - |
Sequence
Protein
Download Length: 148 a.a. Molecular weight: 17102.82 Da Isoelectric Point: 8.2376
>NTDB_id=92526 Llc71_RS11945 WP_011836043.1 2332329..2332775(-) (comGF) [Lactococcus cremoris strain 7-1]
MERKFCDLKLKIRAFTLLECLVALLAISGSVLVISGLTRMIEEQMKISQNDSRKDWQIFCEQMRSELSGAKLDNVNQNFL
YVTKDKKLRFGLVGDDFRKSDDKGQGYQPMLYDLKGAKIQAEENLIKITIDFDNGGERVFIYRFTDTK
MERKFCDLKLKIRAFTLLECLVALLAISGSVLVISGLTRMIEEQMKISQNDSRKDWQIFCEQMRSELSGAKLDNVNQNFL
YVTKDKKLRFGLVGDDFRKSDDKGQGYQPMLYDLKGAKIQAEENLIKITIDFDNGGERVFIYRFTDTK
Nucleotide
Download Length: 447 bp
>NTDB_id=92526 Llc71_RS11945 WP_011836043.1 2332329..2332775(-) (comGF) [Lactococcus cremoris strain 7-1]
ATGGAAAGGAAATTTTGCGACTTGAAGCTCAAAATTAGGGCATTTACTTTACTAGAATGTCTCGTAGCACTTTTGGCAAT
TTCTGGTTCAGTGCTAGTCATCTCAGGGCTGACTAGAATGATTGAAGAACAGATGAAAATAAGCCAGAATGATAGTAGGA
AAGATTGGCAAATATTTTGTGAACAAATGCGTTCAGAACTCTCCGGAGCAAAATTAGACAATGTGAATCAAAATTTTTTG
TATGTGACCAAAGATAAGAAGTTACGGTTCGGATTAGTAGGGGATGATTTTCGTAAAAGTGATGATAAAGGGCAAGGATA
CCAACCGATGCTTTATGATTTAAAAGGAGCAAAAATTCAGGCAGAAGAAAATTTGATAAAAATAACAATTGATTTTGATA
ATGGAGGTGAGCGAGTATTTATTTATCGATTTACAGATACAAAGTAA
ATGGAAAGGAAATTTTGCGACTTGAAGCTCAAAATTAGGGCATTTACTTTACTAGAATGTCTCGTAGCACTTTTGGCAAT
TTCTGGTTCAGTGCTAGTCATCTCAGGGCTGACTAGAATGATTGAAGAACAGATGAAAATAAGCCAGAATGATAGTAGGA
AAGATTGGCAAATATTTTGTGAACAAATGCGTTCAGAACTCTCCGGAGCAAAATTAGACAATGTGAATCAAAATTTTTTG
TATGTGACCAAAGATAAGAAGTTACGGTTCGGATTAGTAGGGGATGATTTTCGTAAAAGTGATGATAAAGGGCAAGGATA
CCAACCGATGCTTTATGATTTAAAAGGAGCAAAAATTCAGGCAGAAGAAAATTTGATAAAAATAACAATTGATTTTGATA
ATGGAGGTGAGCGAGTATTTATTTATCGATTTACAGATACAAAGTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGF | Lactococcus lactis subsp. cremoris KW2 |
99.291 |
95.27 |
0.946 |
| comYF | Streptococcus mutans UA140 |
44.681 |
95.27 |
0.426 |
| comYF | Streptococcus mutans UA159 |
43.972 |
95.27 |
0.419 |
| comGF/cglF | Streptococcus mitis SK321 |
39.286 |
94.595 |
0.372 |
| comGF/cglF | Streptococcus mitis NCTC 12261 |
39.286 |
94.595 |
0.372 |