Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssb   Type   Machinery gene
Locus tag   MFE95_RS06260 Genome accession   NZ_AP025519
Coordinates   1254647..1255111 (+) Length   154 a.a.
NCBI ID   WP_238300544.1    Uniprot ID   -
Organism   Pasteurella multocida strain Pm1     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1217634..1260388 1254647..1255111 within 0


Gene organization within MGE regions


Location: 1217634..1260388
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MFE95_RS06030 (PASm1_11730) - 1217634..1217957 (-) 324 WP_016569978.1 hypothetical protein -
  MFE95_RS06035 (PASm1_11740) gpJ 1218005..1223899 (-) 5895 WP_238300537.1 TipJ family phage tail tip protein -
  MFE95_RS06040 (PASm1_11750) - 1223903..1224523 (-) 621 WP_014667799.1 tail assembly protein -
  MFE95_RS06045 (PASm1_11760) - 1224466..1225209 (-) 744 WP_102827075.1 C40 family peptidase -
  MFE95_RS06050 (PASm1_11770) - 1225214..1225927 (-) 714 WP_023430089.1 phage minor tail protein L -
  MFE95_RS06055 (PASm1_11780) - 1226064..1226414 (-) 351 WP_005719622.1 phage tail protein -
  MFE95_RS06060 (PASm1_11790) - 1226411..1228564 (-) 2154 WP_238300235.1 phage tail length tape measure family protein -
  MFE95_RS13220 (PASm1_11800) - 1228551..1228745 (-) 195 WP_420488825.1 hypothetical protein -
  MFE95_RS06070 (PASm1_11810) - 1228874..1229263 (-) 390 WP_061406079.1 phage minor tail protein G -
  MFE95_RS06075 (PASm1_11820) - 1229266..1229775 (-) 510 WP_115098329.1 phage tail tube protein -
  MFE95_RS06080 (PASm1_11830) gpU 1229772..1230179 (-) 408 WP_223131948.1 phage minor tail U family protein -
  MFE95_RS06085 (PASm1_11840) - 1230176..1230727 (-) 552 WP_223131947.1 phage tail protein -
  MFE95_RS06090 (PASm1_11850) - 1230727..1231020 (-) 294 WP_005719722.1 hypothetical protein -
  MFE95_RS06095 (PASm1_11860) - 1231013..1231339 (-) 327 WP_016570083.1 DUF2190 family protein -
  MFE95_RS06100 (PASm1_11870) - 1231410..1233428 (-) 2019 WP_238300233.1 ClpP-like prohead protease/major capsid protein fusion protein -
  MFE95_RS06105 (PASm1_11880) - 1233364..1234902 (-) 1539 WP_238300232.1 phage portal protein -
  MFE95_RS06110 (PASm1_11890) - 1234899..1235120 (-) 222 WP_014391481.1 hypothetical protein -
  MFE95_RS06115 (PASm1_11900) - 1235117..1237225 (-) 2109 WP_238300231.1 phage terminase large subunit family protein -
  MFE95_RS06120 (PASm1_11910) - 1237228..1237704 (-) 477 WP_075269225.1 DUF1441 family protein -
  MFE95_RS06125 (PASm1_11920) - 1237963..1238139 (+) 177 WP_016533221.1 type II toxin-antitoxin system HicA family toxin -
  MFE95_RS06130 (PASm1_11930) - 1238187..1238603 (+) 417 WP_016533220.1 type II toxin-antitoxin system HicB family antitoxin -
  MFE95_RS06135 (PASm1_11940) lysC 1238641..1238922 (-) 282 WP_420488823.1 Rz1-like lysis system protein LysC -
  MFE95_RS06140 (PASm1_11950) - 1238828..1239151 (-) 324 WP_016569983.1 DUF2570 family protein -
  MFE95_RS06145 (PASm1_11960) - 1239154..1239738 (-) 585 WP_016533462.1 glycoside hydrolase family 19 protein -
  MFE95_RS06150 (PASm1_11970) - 1239710..1240075 (-) 366 WP_016533461.1 phage holin, lambda family -
  MFE95_RS06155 (PASm1_11980) - 1240453..1240668 (+) 216 WP_015691066.1 ECs_2282 family putative zinc-binding protein -
  MFE95_RS06160 (PASm1_11990) - 1240877..1241242 (-) 366 WP_016533470.1 antiterminator Q family protein -
  MFE95_RS06165 (PASm1_12000) - 1241242..1241844 (-) 603 WP_016533469.1 recombination protein NinG -
  MFE95_RS06170 (PASm1_12010) - 1241932..1242144 (-) 213 WP_016533468.1 hypothetical protein -
  MFE95_RS06175 (PASm1_12020) - 1242218..1242676 (-) 459 WP_016569985.1 recombination protein NinB -
  MFE95_RS06180 (PASm1_12030) - 1242666..1243202 (-) 537 WP_014391470.1 phage N-6-adenine-methyltransferase -
  MFE95_RS06185 (PASm1_12040) - 1243206..1244645 (-) 1440 WP_238300296.1 DnaB-like helicase C-terminal domain-containing protein -
  MFE95_RS06190 (PASm1_12050) - 1244645..1245484 (-) 840 WP_071523827.1 DNA replication protein -
  MFE95_RS06195 (PASm1_12060) - 1245569..1246270 (-) 702 WP_064775604.1 phage antirepressor KilAC domain-containing protein -
  MFE95_RS06200 (PASm1_12070) - 1246329..1246781 (-) 453 WP_238300539.1 phage regulatory CII family protein -
  MFE95_RS06205 (PASm1_12080) - 1246830..1247030 (-) 201 WP_075266297.1 transcriptional regulator -
  MFE95_RS06210 (PASm1_12090) - 1247152..1247838 (+) 687 WP_075266295.1 S24 family peptidase -
  MFE95_RS06215 (PASm1_12100) - 1248042..1249886 (+) 1845 WP_071523830.1 DEAD/DEAH box helicase -
  MFE95_RS06220 (PASm1_12110) - 1249916..1250320 (+) 405 WP_238300541.1 hypothetical protein -
  MFE95_RS06225 (PASm1_12120) - 1250877..1251107 (+) 231 WP_016533507.1 hypothetical protein -
  MFE95_RS06230 (PASm1_12130) - 1251477..1252154 (+) 678 WP_075266291.1 BRO family protein -
  MFE95_RS06235 (PASm1_12140) - 1252239..1252538 (+) 300 WP_014390709.1 hypothetical protein -
  MFE95_RS06240 (PASm1_12150) - 1252510..1252746 (+) 237 WP_075266289.1 hypothetical protein -
  MFE95_RS06245 (PASm1_12160) - 1252759..1253046 (+) 288 WP_064964850.1 hypothetical protein -
  MFE95_RS06250 (PASm1_12170) - 1253048..1254001 (+) 954 WP_014391451.1 recombinase RecT -
  MFE95_RS06255 (PASm1_12180) - 1253988..1254647 (+) 660 WP_041423209.1 translocation protein TolB precursor -
  MFE95_RS06260 (PASm1_12190) ssb 1254647..1255111 (+) 465 WP_238300544.1 single-stranded DNA-binding protein Machinery gene
  MFE95_RS06265 (PASm1_12200) - 1255123..1255314 (+) 192 WP_016533530.1 hypothetical protein -
  MFE95_RS06270 (PASm1_12210) - 1255357..1255710 (+) 354 WP_016570064.1 hypothetical protein -
  MFE95_RS06275 (PASm1_12220) - 1255782..1256570 (+) 789 WP_014391448.1 DUF2303 family protein -
  MFE95_RS06280 (PASm1_12230) - 1256623..1257222 (+) 600 WP_016569996.1 hypothetical protein -
  MFE95_RS06285 (PASm1_12240) - 1257219..1257509 (+) 291 WP_016569997.1 hypothetical protein -
  MFE95_RS06290 (PASm1_12250) - 1257543..1258025 (+) 483 WP_238300554.1 class I SAM-dependent methyltransferase -
  MFE95_RS06295 (PASm1_12260) - 1258028..1258462 (+) 435 WP_238300287.1 DUF551 domain-containing protein -
  MFE95_RS06300 (PASm1_12270) - 1258474..1258959 (+) 486 WP_238300412.1 DUF551 domain-containing protein -
  MFE95_RS06305 (PASm1_12280) - 1259121..1259402 (+) 282 WP_047918098.1 hypothetical protein -
  MFE95_RS06310 (PASm1_12290) - 1259399..1260388 (-) 990 WP_139617332.1 tyrosine-type recombinase/integrase -

Sequence


Protein


Download         Length: 154 a.a.        Molecular weight: 17177.96 Da        Isoelectric Point: 5.9165

>NTDB_id=92473 MFE95_RS06260 WP_238300544.1 1254647..1255111(+) (ssb) [Pasteurella multocida strain Pm1]
MAGVNKVIIVGNLGNDPEIRTMPNGEAVANISVATSESWIDKNTGERKTQTEWHSIVFYRRQAEICGQYLKKGSKVYVEG
RLRTRKWQDQNGQDRYTTEIQGDVLQMLDSRQDSQAQANAQANAQAPQNNAYANAKAGKPVQQADSFEDDSIPF

Nucleotide


Download         Length: 465 bp        

>NTDB_id=92473 MFE95_RS06260 WP_238300544.1 1254647..1255111(+) (ssb) [Pasteurella multocida strain Pm1]
ATGGCTGGAGTCAATAAAGTAATTATTGTAGGAAACTTAGGTAACGATCCTGAAATCCGCACAATGCCAAATGGTGAAGC
CGTAGCCAATATCAGTGTCGCCACAAGCGAAAGTTGGATCGACAAAAATACTGGCGAACGAAAAACACAAACTGAATGGC
ATTCTATCGTGTTCTATCGTCGCCAAGCAGAAATTTGCGGTCAGTATCTCAAAAAAGGATCGAAAGTGTATGTGGAAGGG
CGTTTAAGAACTCGTAAATGGCAAGACCAAAACGGGCAAGACCGCTACACCACTGAAATCCAAGGCGACGTATTGCAGAT
GTTAGACAGTCGCCAAGATTCACAAGCACAAGCTAACGCACAAGCTAACGCACAAGCACCGCAAAACAATGCTTATGCCA
ATGCGAAAGCTGGAAAGCCAGTGCAACAGGCTGATAGTTTTGAAGATGATAGCATACCTTTTTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Glaesserella parasuis strain SC1401

62.431

100

0.734

  ssb Vibrio cholerae strain A1552

49.425

100

0.558

  ssb Neisseria meningitidis MC58

44.509

100

0.5

  ssb Neisseria gonorrhoeae MS11

44.509

100

0.5


Multiple sequence alignment