Detailed information    

insolico Bioinformatically predicted

Overview

Name   ssb   Type   Machinery gene
Locus tag   VIL75_RS14185 Genome accession   NZ_CP141835
Coordinates   3000884..3001378 (+) Length   164 a.a.
NCBI ID   WP_409045478.1    Uniprot ID   -
Organism   Proteus mirabilis strain KUST-1312     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 2961821..3007907 3000884..3001378 within 0


Gene organization within MGE regions


Location: 2961821..3007907
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  VIL75_RS13880 - 2961821..2962012 (+) 192 WP_159290169.1 DNA polymerase III subunit theta -
  VIL75_RS13885 - 2962042..2964411 (-) 2370 WP_159290170.1 hypothetical protein -
  VIL75_RS13890 - 2964464..2966932 (-) 2469 WP_159290171.1 host specificity factor TipJ family phage tail protein -
  VIL75_RS13895 - 2966919..2967311 (-) 393 WP_159290172.1 NlpC/P60 family protein -
  VIL75_RS13900 - 2967308..2967778 (-) 471 WP_159290173.1 DUF1833 family protein -
  VIL75_RS13905 - 2967778..2968254 (-) 477 WP_109409994.1 hypothetical protein -
  VIL75_RS13910 - 2968258..2971659 (-) 3402 WP_409045471.1 tape measure protein -
  VIL75_RS13915 bamE 2971723..2972103 (-) 381 WP_159290175.1 outer membrane protein assembly factor BamE -
  VIL75_RS13920 - 2972173..2972865 (-) 693 WP_159290176.1 DUF6246 family protein -
  VIL75_RS13925 - 2972915..2973670 (-) 756 WP_063073751.1 Ig-like domain-containing protein -
  VIL75_RS13930 - 2973735..2974103 (-) 369 WP_159290177.1 hypothetical protein -
  VIL75_RS13935 - 2974100..2974468 (-) 369 WP_159290178.1 HK97 gp10 family phage protein -
  VIL75_RS13940 - 2974470..2974811 (-) 342 WP_159290179.1 hypothetical protein -
  VIL75_RS13945 - 2974811..2975209 (-) 399 WP_159290180.1 hypothetical protein -
  VIL75_RS13950 - 2975266..2975439 (-) 174 WP_004247764.1 hypothetical protein -
  VIL75_RS13955 - 2975449..2976543 (-) 1095 WP_143475544.1 major capsid protein -
  VIL75_RS13960 - 2976559..2977005 (-) 447 WP_049257612.1 hypothetical protein -
  VIL75_RS13965 - 2977005..2978279 (-) 1275 WP_143475546.1 hypothetical protein -
  VIL75_RS13970 - 2978283..2979212 (-) 930 WP_143475547.1 phage minor head protein -
  VIL75_RS13975 - 2979163..2980518 (-) 1356 WP_409045472.1 anti-CBASS protein Acb1 family protein -
  VIL75_RS13980 - 2980518..2981768 (-) 1251 WP_143475551.1 PBSX family phage terminase large subunit -
  VIL75_RS13985 - 2981752..2982177 (-) 426 WP_036905466.1 DNA-packaging protein -
  VIL75_RS13990 - 2982194..2982379 (-) 186 WP_063073743.1 hypothetical protein -
  VIL75_RS13995 - 2982358..2982573 (-) 216 WP_143475553.1 hypothetical protein -
  VIL75_RS14000 - 2982604..2982762 (-) 159 WP_165439123.1 hypothetical protein -
  VIL75_RS14005 - 2982759..2982965 (-) 207 WP_004245979.1 hypothetical protein -
  VIL75_RS14010 - 2982962..2983546 (-) 585 WP_159290183.1 Bro-N domain-containing protein -
  VIL75_RS14015 - 2983998..2984162 (-) 165 WP_159290184.1 hypothetical protein -
  VIL75_RS14020 - 2984215..2984370 (-) 156 WP_159290185.1 hypothetical protein -
  VIL75_RS14025 - 2984537..2984917 (-) 381 WP_143475401.1 hypothetical protein -
  VIL75_RS14030 - 2984914..2985318 (-) 405 WP_143475400.1 structural protein -
  VIL75_RS14035 - 2985315..2985620 (-) 306 WP_049199107.1 phage holin family protein -
  VIL75_RS14045 - 2986146..2986760 (-) 615 WP_109937974.1 DUF1133 family protein -
  VIL75_RS14050 - 2986757..2986948 (-) 192 WP_143475399.1 hypothetical protein -
  VIL75_RS14055 - 2987101..2987694 (-) 594 WP_143475398.1 recombination protein NinG -
  VIL75_RS14060 - 2987666..2987809 (-) 144 WP_159290187.1 hypothetical protein -
  VIL75_RS14065 - 2987806..2988468 (-) 663 WP_143475397.1 metallophosphoesterase -
  VIL75_RS14070 - 2988611..2989054 (-) 444 WP_112842880.1 recombination protein NinB -
  VIL75_RS14075 - 2989056..2989265 (-) 210 WP_161779684.1 hypothetical protein -
  VIL75_RS14080 - 2989258..2989452 (-) 195 WP_161779683.1 Lar family restriction alleviation protein -
  VIL75_RS14085 - 2989660..2989887 (-) 228 WP_161779682.1 hypothetical protein -
  VIL75_RS14090 - 2989884..2990093 (-) 210 WP_161779681.1 DUF551 domain-containing protein -
  VIL75_RS14095 - 2990291..2990458 (-) 168 WP_152964332.1 hypothetical protein -
  VIL75_RS14100 - 2990469..2990672 (-) 204 WP_409045473.1 hypothetical protein -
  VIL75_RS14105 - 2990692..2992068 (-) 1377 WP_161779680.1 replicative DNA helicase -
  VIL75_RS14110 - 2992068..2993240 (-) 1173 WP_237611982.1 conserved phage C-terminal domain-containing protein -
  VIL75_RS14115 - 2993233..2993457 (-) 225 WP_197570618.1 hypothetical protein -
  VIL75_RS14120 - 2993501..2993881 (-) 381 WP_063693284.1 hypothetical protein -
  VIL75_RS14125 - 2994016..2994201 (-) 186 WP_036895075.1 Cro/CI family transcriptional regulator -
  VIL75_RS14130 - 2994297..2995007 (+) 711 WP_060556824.1 LexA family transcriptional regulator -
  VIL75_RS14135 - 2995089..2995418 (+) 330 WP_058336229.1 type II toxin-antitoxin system RelE/ParE family toxin -
  VIL75_RS14140 - 2995411..2996523 (+) 1113 WP_049200762.1 helix-turn-helix domain-containing protein -
  VIL75_RS14145 - 2996910..2997203 (+) 294 WP_161779678.1 hypothetical protein -
  VIL75_RS14150 - 2997214..2998047 (+) 834 WP_161779677.1 hypothetical protein -
  VIL75_RS14155 - 2998428..2998712 (+) 285 WP_409045474.1 hypothetical protein -
  VIL75_RS14160 - 2998714..2998857 (+) 144 WP_260282380.1 hypothetical protein -
  VIL75_RS14165 - 2998945..2999121 (+) 177 WP_409045475.1 hypothetical protein -
  VIL75_RS14170 - 2999255..2999509 (+) 255 WP_165122584.1 hypothetical protein -
  VIL75_RS14175 - 2999506..3000330 (+) 825 WP_409045476.1 PD-(D/E)XK nuclease-like domain-containing protein -
  VIL75_RS14180 - 3000330..3000884 (+) 555 WP_409045477.1 hypothetical protein -
  VIL75_RS14185 ssb 3000884..3001378 (+) 495 WP_409045478.1 single-stranded DNA-binding protein Machinery gene
  VIL75_RS14190 - 3001409..3001570 (+) 162 WP_159290201.1 hypothetical protein -
  VIL75_RS14195 - 3001613..3001831 (+) 219 WP_142836744.1 hypothetical protein -
  VIL75_RS14200 - 3001866..3002321 (+) 456 WP_409045479.1 hypothetical protein -
  VIL75_RS14205 - 3002391..3002948 (+) 558 WP_164527028.1 hypothetical protein -
  VIL75_RS14210 - 3003030..3003164 (+) 135 WP_286447960.1 hypothetical protein -
  VIL75_RS14215 - 3003154..3003327 (+) 174 WP_168713144.1 hypothetical protein -
  VIL75_RS14220 - 3003320..3003646 (+) 327 WP_286447961.1 phage protein NinX family protein -
  VIL75_RS14225 - 3003633..3004235 (+) 603 Protein_2756 MT-A70 family methyltransferase -
  VIL75_RS14230 - 3004524..3004856 (+) 333 WP_159290206.1 helix-turn-helix domain-containing protein -
  VIL75_RS14235 - 3004739..3005896 (+) 1158 WP_242631538.1 site-specific integrase -
  VIL75_RS14245 folD 3006179..3007051 (+) 873 WP_004244243.1 bifunctional methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase FolD -
  VIL75_RS14250 ybcJ 3007055..3007267 (+) 213 WP_004244244.1 ribosome-associated protein YbcJ -

Sequence

Protein


Download         Length: 164 a.a.        Molecular weight: 17956.96 Da        Isoelectric Point: 6.4646

>NTDB_id=920077 VIL75_RS14185 WP_409045478.1 3000884..3001378(+) (ssb) [Proteus mirabilis strain KUST-1312]
MASKGVNKVILIGHLGQDPEIRYMPSGGAVANLTLATSESWRDKQTGEMKEKTEWHRVCIFGKLAEIAGEYLRKGSQVYI
EGSLQTRKWQDQSGQDRYTTEVVVNIGGSMQMLGGNGGNQAGSQRPQQNQGCGQPQQPQAPKQASGNQAPQSEPPQDWDD
QIPF

Nucleotide


Download         Length: 495 bp        

>NTDB_id=920077 VIL75_RS14185 WP_409045478.1 3000884..3001378(+) (ssb) [Proteus mirabilis strain KUST-1312]
ATGGCAAGTAAAGGCGTAAACAAGGTAATTCTCATCGGCCACTTGGGGCAAGACCCTGAAATCCGCTATATGCCATCAGG
TGGCGCTGTTGCAAATCTCACATTAGCCACATCGGAATCGTGGCGTGATAAGCAGACTGGTGAGATGAAGGAGAAAACTG
AGTGGCATCGAGTGTGCATCTTCGGAAAATTAGCCGAAATTGCAGGTGAATATCTGAGAAAAGGAAGTCAGGTATATATC
GAGGGCTCACTGCAAACCAGAAAATGGCAAGACCAAAGCGGGCAAGACCGATACACAACGGAAGTAGTGGTTAATATCGG
CGGTTCTATGCAAATGCTAGGCGGTAACGGTGGTAATCAGGCAGGAAGCCAGAGGCCACAACAGAATCAAGGATGTGGTC
AGCCACAGCAACCGCAAGCACCAAAACAAGCATCAGGTAATCAAGCACCACAAAGTGAGCCACCTCAAGATTGGGATGAT
CAAATACCCTTCTAA

Domains

Predicted by InterproScan.

Single-strand binding protein family (SSB)

(6-112)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Vibrio cholerae strain A1552

68.927

100

0.744
  ssb Glaesserella parasuis strain SC1401

53.039

100

0.585
  ssb Neisseria meningitidis MC58

44.886

100

0.482
  ssb Neisseria gonorrhoeae MS11

44.318

100

0.476