Detailed information    

insolico Bioinformatically predicted

Overview

Name   comB7   Type   Machinery gene
Locus tag   VA243_RS05440 Genome accession   NZ_CP141774
Coordinates   1123458..1123583 (-) Length   41 a.a.
NCBI ID   WP_001217874.1    Uniprot ID   A0AAI7ZWZ6
Organism   Helicobacter pylori strain P07353     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 1118458..1128583
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  VA243_RS05420 - 1119145..1120557 (-) 1413 WP_324714410.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -
  VA243_RS05425 comB10 1120627..1121763 (-) 1137 WP_212776919.1 DNA type IV secretion system protein ComB10 Machinery gene
  VA243_RS05430 comB9 1121756..1122718 (-) 963 WP_324714411.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  VA243_RS05435 comB8 1122718..1123461 (-) 744 WP_324714412.1 virB8 family protein Machinery gene
  VA243_RS05440 comB7 1123458..1123583 (-) 126 WP_001217874.1 hypothetical protein Machinery gene
  VA243_RS05445 comB6 1123599..1124654 (-) 1056 WP_324714413.1 P-type conjugative transfer protein TrbL Machinery gene
  VA243_RS05450 - 1124660..1125655 (-) 996 WP_324715122.1 PDZ domain-containing protein -
  VA243_RS05455 - 1125655..1125948 (-) 294 WP_000347917.1 YbaB/EbfC family nucleoid-associated protein -
  VA243_RS05460 panD 1125959..1126309 (-) 351 WP_324714415.1 aspartate 1-decarboxylase -
  VA243_RS05465 - 1126299..1128521 (-) 2223 WP_324714416.1 ATP-dependent Clp protease ATP-binding subunit -

Sequence

Protein


Download         Length: 41 a.a.        Molecular weight: 4798.82 Da        Isoelectric Point: 9.3278

>NTDB_id=919408 VA243_RS05440 WP_001217874.1 1123458..1123583(-) (comB7) [Helicobacter pylori strain P07353]
MRIFFVIMGLVLFGCTSKVHEMKKSPCTLHEKLYENRLNLA

Nucleotide


Download         Length: 126 bp        

>NTDB_id=919408 VA243_RS05440 WP_001217874.1 1123458..1123583(-) (comB7) [Helicobacter pylori strain P07353]
ATGAGAATTTTTTTTGTCATTATGGGACTAGTATTGTTTGGTTGCACCAGTAAGGTGCATGAAATGAAAAAAAGCCCTTG
CACATTGCATGAAAAGTTATATGAAAACAGGTTGAATCTCGCATGA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

87.805

100

0.878