Detailed information    

insolico Bioinformatically predicted

Overview

Name   comB7   Type   Machinery gene
Locus tag   VA210_RS02840 Genome accession   NZ_CP141773
Coordinates   598922..599047 (-) Length   41 a.a.
NCBI ID   WP_001217874.1    Uniprot ID   A0AAI7ZWZ6
Organism   Helicobacter pylori strain P08205     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 593922..604047
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  VA210_RS02820 - 594609..596021 (-) 1413 WP_324714060.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -
  VA210_RS02825 comB10 596091..597227 (-) 1137 WP_324714061.1 DNA type IV secretion system protein ComB10 Machinery gene
  VA210_RS02830 comB9 597220..598182 (-) 963 WP_324714062.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  VA210_RS02835 comB8 598182..598925 (-) 744 WP_221004244.1 type IV secretion system protein Machinery gene
  VA210_RS02840 comB7 598922..599047 (-) 126 WP_001217874.1 hypothetical protein Machinery gene
  VA210_RS02845 comB6 599063..600118 (-) 1056 WP_324714182.1 P-type conjugative transfer protein TrbL Machinery gene
  VA210_RS02850 - 600124..601119 (-) 996 WP_324714183.1 PDZ domain-containing protein -
  VA210_RS02855 - 601119..601412 (-) 294 WP_000347916.1 YbaB/EbfC family nucleoid-associated protein -
  VA210_RS02860 panD 601423..601773 (-) 351 WP_000142208.1 aspartate 1-decarboxylase -
  VA210_RS02865 - 601763..603985 (-) 2223 WP_324714063.1 ATP-dependent Clp protease ATP-binding subunit -

Sequence

Protein


Download         Length: 41 a.a.        Molecular weight: 4798.82 Da        Isoelectric Point: 9.3278

>NTDB_id=919382 VA210_RS02840 WP_001217874.1 598922..599047(-) (comB7) [Helicobacter pylori strain P08205]
MRIFFVIMGLVLFGCTSKVHEMKKSPCTLHEKLYENRLNLA

Nucleotide


Download         Length: 126 bp        

>NTDB_id=919382 VA210_RS02840 WP_001217874.1 598922..599047(-) (comB7) [Helicobacter pylori strain P08205]
ATGAGAATTTTTTTTGTCATTATGGGACTAGTATTGTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACATTGCATGAAAAGTTATATGAAAACAGGTTGAATCTTGCATGA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

87.805

100

0.878