Detailed information    

insolico Bioinformatically predicted

Overview

Name   comB7   Type   Machinery gene
Locus tag   VA211_RS00725 Genome accession   NZ_CP141771
Coordinates   147960..148085 (+) Length   41 a.a.
NCBI ID   WP_001217865.1    Uniprot ID   -
Organism   Helicobacter pylori strain P08204     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 142960..153085
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  VA211_RS00700 - 143020..145242 (+) 2223 WP_324685411.1 ATP-dependent Clp protease ATP-binding subunit -
  VA211_RS00705 panD 145232..145582 (+) 351 WP_000142208.1 aspartate 1-decarboxylase -
  VA211_RS00710 - 145593..145886 (+) 294 WP_000347922.1 YbaB/EbfC family nucleoid-associated protein -
  VA211_RS00715 - 145886..146881 (+) 996 WP_324686334.1 PDZ domain-containing protein -
  VA211_RS00720 comB6 146889..147944 (+) 1056 WP_324686336.1 P-type conjugative transfer protein TrbL Machinery gene
  VA211_RS00725 comB7 147960..148085 (+) 126 WP_001217865.1 hypothetical protein Machinery gene
  VA211_RS00730 comB8 148082..148819 (+) 738 WP_324685419.1 virB8 family protein Machinery gene
  VA211_RS00735 comB9 148819..149781 (+) 963 WP_324685421.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  VA211_RS00740 comB10 149774..150910 (+) 1137 WP_324685423.1 DNA type IV secretion system protein ComB10 Machinery gene
  VA211_RS00745 - 150976..152387 (+) 1412 Protein_144 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -

Sequence

Protein


Download         Length: 41 a.a.        Molecular weight: 4794.82 Da        Isoelectric Point: 9.3278

>NTDB_id=919357 VA211_RS00725 WP_001217865.1 147960..148085(+) (comB7) [Helicobacter pylori strain P08204]
MRIFFVIIGLILFGCTSKVHEMKKSPCTLHEKLYENRLNLA

Nucleotide


Download         Length: 126 bp        

>NTDB_id=919357 VA211_RS00725 WP_001217865.1 147960..148085(+) (comB7) [Helicobacter pylori strain P08204]
ATGAGAATTTTTTTTGTTATTATTGGACTAATATTGTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACATTGCATGAAAAGTTATATGAAAACAGGTTAAATCTCGCATGA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

82.927

100

0.829