Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssb   Type   Machinery gene
Locus tag   U9I39_RS03775 Genome accession   NZ_CP141589
Coordinates   773329..773766 (+) Length   145 a.a.
NCBI ID   WP_277848044.1    Uniprot ID   -
Organism   Lacticaseibacillus rhamnosus strain S22825     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 764966..806049 773329..773766 within 0


Gene organization within MGE regions


Location: 764966..806049
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  U9I39_RS03705 (U9I39_03705) - 764966..766093 (-) 1128 WP_260182650.1 site-specific integrase -
  U9I39_RS03710 (U9I39_03710) - 766202..766465 (-) 264 WP_015764315.1 hypothetical protein -
  U9I39_RS03715 (U9I39_03715) - 766563..766973 (-) 411 WP_225361932.1 hypothetical protein -
  U9I39_RS03720 (U9I39_03720) - 767588..768433 (-) 846 WP_081262708.1 SHOCT domain-containing protein -
  U9I39_RS03725 (U9I39_03725) - 768493..769158 (-) 666 WP_345939202.1 XRE family transcriptional regulator -
  U9I39_RS03730 (U9I39_03730) - 769327..769593 (+) 267 WP_095593593.1 helix-turn-helix transcriptional regulator -
  U9I39_RS03735 (U9I39_03735) - 769594..770298 (+) 705 WP_346222692.1 phage regulatory protein/antirepressor Ant -
  U9I39_RS03740 (U9I39_03740) - 770299..770556 (+) 258 WP_346222693.1 hypothetical protein -
  U9I39_RS03745 (U9I39_03745) - 770637..770993 (+) 357 WP_316069659.1 DUF771 domain-containing protein -
  U9I39_RS03750 (U9I39_03750) - 771078..771230 (+) 153 WP_260183811.1 hypothetical protein -
  U9I39_RS03755 (U9I39_03755) - 771235..771438 (+) 204 WP_277848038.1 hypothetical protein -
  U9I39_RS03760 (U9I39_03760) - 771456..771947 (+) 492 WP_277848039.1 siphovirus Gp157 family protein -
  U9I39_RS03765 (U9I39_03765) - 771958..772668 (+) 711 WP_223602867.1 ERF family protein -
  U9I39_RS03770 (U9I39_03770) - 772646..773314 (+) 669 WP_277848043.1 putative HNHc nuclease -
  U9I39_RS03775 (U9I39_03775) ssb 773329..773766 (+) 438 WP_277848044.1 single-stranded DNA-binding protein Machinery gene
  U9I39_RS03780 (U9I39_03780) - 773783..774613 (+) 831 WP_277848045.1 helix-turn-helix domain-containing protein -
  U9I39_RS03785 (U9I39_03785) - 774610..775872 (+) 1263 WP_346222694.1 DnaB-like helicase C-terminal domain-containing protein -
  U9I39_RS03790 (U9I39_03790) - 775874..776218 (+) 345 WP_260182640.1 hypothetical protein -
  U9I39_RS03795 (U9I39_03795) - 776260..776661 (+) 402 WP_346222695.1 RusA family crossover junction endodeoxyribonuclease -
  U9I39_RS03800 (U9I39_03800) - 776677..777153 (+) 477 WP_346222696.1 alcohol dehydrogenase -
  U9I39_RS03805 (U9I39_03805) - 777168..777353 (+) 186 WP_049152787.1 hypothetical protein -
  U9I39_RS03810 (U9I39_03810) - 777350..777856 (+) 507 WP_049152786.1 DUF1642 domain-containing protein -
  U9I39_RS03815 (U9I39_03815) - 777846..778190 (+) 345 WP_003585025.1 hypothetical protein -
  U9I39_RS03820 (U9I39_03820) - 778177..778551 (+) 375 WP_346222697.1 hypothetical protein -
  U9I39_RS03825 (U9I39_03825) - 778548..778991 (+) 444 WP_021354235.1 YopX family protein -
  U9I39_RS03830 (U9I39_03830) - 779609..780052 (+) 444 WP_048487187.1 ArpU family phage packaging/lysis transcriptional regulator -
  U9I39_RS03835 (U9I39_03835) - 780364..781296 (+) 933 WP_047676130.1 hypothetical protein -
  U9I39_RS03840 (U9I39_03840) - 781839..782987 (+) 1149 WP_260182632.1 GcrA family cell cycle regulator -
  U9I39_RS03845 (U9I39_03845) - 782980..783516 (+) 537 WP_260182631.1 NUMOD4 domain-containing protein -
  U9I39_RS03850 (U9I39_03850) - 783520..783849 (+) 330 WP_346222698.1 ribonucleoside-diphosphate reductase -
  U9I39_RS03855 (U9I39_03855) - 783855..784205 (+) 351 Protein_731 hypothetical protein -
  U9I39_RS03860 (U9I39_03860) - 784238..784402 (+) 165 WP_346222699.1 hypothetical protein -
  U9I39_RS03865 (U9I39_03865) - 784408..784896 (+) 489 WP_346222700.1 HNH endonuclease -
  U9I39_RS03870 (U9I39_03870) - 785031..785504 (+) 474 WP_346222701.1 phage terminase small subunit P27 family -
  U9I39_RS03875 (U9I39_03875) - 785501..787393 (+) 1893 WP_346222702.1 terminase TerL endonuclease subunit -
  U9I39_RS03880 (U9I39_03880) - 787380..787589 (+) 210 WP_346222704.1 hypothetical protein -
  U9I39_RS03885 (U9I39_03885) - 787589..788776 (+) 1188 WP_346222705.1 phage portal protein -
  U9I39_RS03890 (U9I39_03890) - 788754..789470 (+) 717 WP_346222706.1 head maturation protease, ClpP-related -
  U9I39_RS03895 (U9I39_03895) - 789470..790711 (+) 1242 WP_346222707.1 phage major capsid protein -
  U9I39_RS03900 (U9I39_03900) - 790783..791091 (+) 309 WP_257586249.1 hypothetical protein -
  U9I39_RS03905 (U9I39_03905) - 791081..791425 (+) 345 WP_257586469.1 phage head closure protein -
  U9I39_RS03910 (U9I39_03910) - 791428..791847 (+) 420 WP_346222709.1 HK97-gp10 family putative phage morphogenesis protein -
  U9I39_RS03915 (U9I39_03915) - 791844..792215 (+) 372 WP_346222710.1 DUF806 family protein -
  U9I39_RS03920 (U9I39_03920) - 792227..792859 (+) 633 WP_346222711.1 phage tail protein -
  U9I39_RS03925 (U9I39_03925) - 793018..793368 (+) 351 WP_064554643.1 phage tail tube assembly chaperone -
  U9I39_RS03930 (U9I39_03930) - 793346..793576 (+) 231 WP_021354705.1 hypothetical protein -
  U9I39_RS03935 (U9I39_03935) - 793549..798150 (+) 4602 WP_346222712.1 tape measure protein -
  U9I39_RS03940 (U9I39_03940) - 798151..800082 (+) 1932 WP_346222713.1 distal tail protein Dit -
  U9I39_RS03945 (U9I39_03945) - 800083..802602 (+) 2520 WP_346222714.1 phage tail protein -
  U9I39_RS03950 (U9I39_03950) - 802618..802947 (+) 330 WP_049179694.1 hypothetical protein -
  U9I39_RS03955 (U9I39_03955) - 802944..803087 (+) 144 WP_005688592.1 XkdX family protein -
  U9I39_RS03960 (U9I39_03960) - 803119..803418 (+) 300 WP_012491468.1 hypothetical protein -
  U9I39_RS03965 (U9I39_03965) - 803433..803846 (+) 414 WP_020752188.1 phage holin -
  U9I39_RS03970 (U9I39_03970) - 803857..805041 (+) 1185 WP_346222715.1 GH25 family lysozyme -
  U9I39_RS03975 (U9I39_03975) - 805145..805657 (+) 513 WP_260182614.1 type II toxin-antitoxin system antitoxin SocA domain-containing protein -
  U9I39_RS03980 (U9I39_03980) - 805654..806049 (+) 396 WP_260182613.1 hypothetical protein -

Sequence


Protein


Download         Length: 145 a.a.        Molecular weight: 15840.42 Da        Isoelectric Point: 5.7222

>NTDB_id=917546 U9I39_RS03775 WP_277848044.1 773329..773766(+) (ssb) [Lacticaseibacillus rhamnosus strain S22825]
MLNSVALTGRLTKPVDLRYTQSGTAVGSFTIAVDRQFRSANGERETDFINCAIWRKSAENFANFTHKGSLVGIEGHIQTR
TYDNAKGQKVFVTEVIVENFALLEPRQASQDGQQRSANNPAAASQGNGFSNNGQQVDVSDDDLPF

Nucleotide


Download         Length: 438 bp        

>NTDB_id=917546 U9I39_RS03775 WP_277848044.1 773329..773766(+) (ssb) [Lacticaseibacillus rhamnosus strain S22825]
ATGCTTAATTCAGTTGCTTTAACAGGCAGATTAACTAAACCGGTTGACCTTCGCTATACGCAAAGCGGAACAGCGGTTGG
TTCATTTACGATTGCTGTTGATCGCCAATTTCGCAGCGCAAATGGGGAACGCGAAACTGACTTCATCAATTGTGCAATCT
GGCGTAAGTCTGCTGAGAATTTTGCCAACTTCACGCACAAGGGTTCACTTGTTGGCATCGAAGGCCATATCCAAACGCGT
ACGTATGATAACGCGAAAGGGCAGAAAGTATTCGTGACCGAGGTAATCGTTGAGAATTTTGCTTTGCTTGAGCCACGGCA
AGCGTCTCAGGATGGTCAACAACGATCGGCTAATAACCCAGCGGCCGCAAGCCAAGGAAACGGTTTTTCTAACAATGGCC
AGCAAGTCGATGTCAGCGATGATGATCTTCCATTCTAG


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Latilactobacillus sakei subsp. sakei 23K

55.294

100

0.648

  ssbA Bacillus subtilis subsp. subtilis str. 168

45.93

100

0.545

  ssbB Streptococcus sobrinus strain NIDR 6715-7

38.621

100

0.386

  ssbB Bacillus subtilis subsp. subtilis str. 168

52.83

73.103

0.386