Detailed information    

insolico Bioinformatically predicted

Overview

Name   ssbA   Type   Machinery gene
Locus tag   L6430_RS21220 Genome accession   NZ_AP025342
Coordinates   4200066..4200542 (-) Length   158 a.a.
NCBI ID   WP_095345962.1    Uniprot ID   -
Organism   Bacillus paralicheniformis strain J41TS8     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 4198868..4241025 4200066..4200542 within 0


Gene organization within MGE regions


Location: 4198868..4241025
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  L6430_RS21220 ssbA 4200066..4200542 (-) 477 WP_095345962.1 single-stranded DNA-binding protein Machinery gene
  L6430_RS21225 - 4200612..4201130 (-) 519 WP_095345964.1 hypothetical protein -
  L6430_RS21230 - 4201678..4201932 (-) 255 WP_095345968.1 hypothetical protein -
  L6430_RS21235 - 4201955..4202365 (-) 411 WP_095345970.1 hypothetical protein -
  L6430_RS21240 - 4202462..4203211 (-) 750 WP_186438878.1 hypothetical protein -
  L6430_RS21245 - 4203392..4203622 (-) 231 WP_085059416.1 hypothetical protein -
  L6430_RS21250 mobP2 4203645..4204886 (-) 1242 WP_085059417.1 MobP2 family relaxase -
  L6430_RS21255 - 4204906..4205322 (-) 417 WP_083460654.1 hypothetical protein -
  L6430_RS21260 - 4205371..4205634 (-) 264 WP_054287334.1 ribbon-helix-helix protein, CopG family -
  L6430_RS21265 - 4205923..4206828 (-) 906 WP_095235661.1 hypothetical protein -
  L6430_RS21270 - 4206849..4207958 (-) 1110 WP_083460669.1 lysozyme family protein -
  L6430_RS21275 - 4207958..4209937 (-) 1980 WP_054287382.1 VirB4 family type IV secretion system protein -
  L6430_RS21280 - 4209950..4210645 (-) 696 WP_095235660.1 hypothetical protein -
  L6430_RS21285 - 4210638..4210979 (-) 342 WP_083460658.1 DUF5592 family protein -
  L6430_RS21290 - 4210976..4213237 (-) 2262 WP_212930414.1 pLS20_p028 family conjugation system transmembrane protein -
  L6430_RS21295 - 4213255..4214004 (-) 750 WP_083460659.1 hypothetical protein -
  L6430_RS21300 - 4214121..4214357 (-) 237 WP_095235658.1 hypothetical protein -
  L6430_RS21305 - 4214472..4215584 (-) 1113 WP_083460657.1 ATPase, T2SS/T4P/T4SS family -
  L6430_RS21310 - 4215600..4216298 (-) 699 WP_095235657.1 flagellar assembly protein FlaJ -
  L6430_RS21315 - 4216351..4218573 (-) 2223 WP_095345980.1 VirD4-like conjugal transfer protein, CD1115 family -
  L6430_RS21320 - 4218592..4218948 (-) 357 WP_083460665.1 hypothetical protein -
  L6430_RS21325 - 4218962..4219375 (-) 414 WP_212930415.1 hypothetical protein -
  L6430_RS21330 - 4219392..4220984 (-) 1593 WP_212930416.1 toprim domain-containing protein -
  L6430_RS21335 - 4220997..4221962 (-) 966 WP_212930417.1 hypothetical protein -
  L6430_RS21340 - 4221959..4222507 (-) 549 WP_098407844.1 hypothetical protein -
  L6430_RS21345 - 4222580..4222768 (-) 189 WP_095345984.1 hypothetical protein -
  L6430_RS21350 - 4222872..4223105 (-) 234 WP_003186634.1 pilin -
  L6430_RS21355 - 4223127..4223366 (-) 240 WP_003186632.1 hypothetical protein -
  L6430_RS21360 - 4223423..4226176 (-) 2754 WP_095345986.1 hypothetical protein -
  L6430_RS21365 - 4226180..4226350 (-) 171 WP_176523203.1 hypothetical protein -
  L6430_RS21370 - 4226380..4226550 (-) 171 WP_164971866.1 hypothetical protein -
  L6430_RS21375 - 4227633..4228718 (-) 1086 WP_176523204.1 DUF262 domain-containing protein -
  L6430_RS21380 - 4228810..4229811 (-) 1002 WP_095345990.1 hypothetical protein -
  L6430_RS21385 - 4229886..4230341 (-) 456 WP_003186624.1 ArpU family phage packaging/lysis transcriptional regulator -
  L6430_RS21390 - 4230515..4230832 (-) 318 WP_126430454.1 hypothetical protein -
  L6430_RS21395 - 4230859..4231149 (-) 291 WP_095345992.1 hypothetical protein -
  L6430_RS21400 - 4231229..4231432 (-) 204 WP_095345993.1 hypothetical protein -
  L6430_RS22920 - 4231506..4231628 (-) 123 WP_255265629.1 hypothetical protein -
  L6430_RS21405 - 4231642..4233008 (-) 1367 Protein_4208 DNA cytosine methyltransferase -
  L6430_RS21410 - 4233044..4233394 (-) 351 WP_085059435.1 hypothetical protein -
  L6430_RS21415 - 4233433..4233606 (-) 174 WP_095345997.1 DNA strand exchange inhibitor protein -
  L6430_RS21420 - 4233632..4233889 (-) 258 WP_035334326.1 hypothetical protein -
  L6430_RS21425 - 4233880..4234215 (-) 336 WP_176523205.1 hypothetical protein -
  L6430_RS21430 - 4234212..4234433 (-) 222 WP_095345999.1 hypothetical protein -
  L6430_RS21435 - 4234743..4234892 (-) 150 WP_128993896.1 BH0509 family protein -
  L6430_RS21440 - 4234906..4235952 (-) 1047 WP_095346001.1 hypothetical protein -
  L6430_RS23170 - 4235993..4236199 (-) 207 WP_003186613.1 helix-turn-helix transcriptional regulator -
  L6430_RS21445 - 4236382..4236786 (+) 405 WP_085059440.1 helix-turn-helix domain-containing protein -
  L6430_RS21450 - 4237021..4237191 (-) 171 WP_158320242.1 hypothetical protein -
  L6430_RS21455 - 4237188..4238306 (-) 1119 WP_212930418.1 AimR family lysis-lysogeny pheromone receptor -
  L6430_RS21460 - 4238389..4238625 (-) 237 WP_050824034.1 hypothetical protein -
  L6430_RS21465 - 4238841..4240454 (+) 1614 WP_085059463.1 recombinase family protein -
  L6430_RS21470 - 4240460..4240765 (+) 306 Protein_4222 sigma-70 family RNA polymerase sigma factor -

Sequence

Protein


Download         Length: 158 a.a.        Molecular weight: 17287.01 Da        Isoelectric Point: 4.7420

>NTDB_id=91498 L6430_RS21220 WP_095345962.1 4200066..4200542(-) (ssbA) [Bacillus paralicheniformis strain J41TS8]
MINRVVLTGRLAKDPILRYTPNGKAVAVFTLAVNRTFTNQQGNREADFINCVAWRNQAENVANFLKKGSLAGVDGRLQTR
SYDNQEGQRVFVTEVQAERVQFLEPKGNGAGSGGGQNVPDSLGSEQSDFNLRSSFNDSDDPFANNGKSIDISDDDLPF

Nucleotide


Download         Length: 477 bp        

>NTDB_id=91498 L6430_RS21220 WP_095345962.1 4200066..4200542(-) (ssbA) [Bacillus paralicheniformis strain J41TS8]
GTGATTAATCGGGTTGTATTGACAGGAAGATTAGCAAAAGATCCTATTTTACGCTATACACCAAACGGAAAAGCTGTGGC
AGTCTTTACACTTGCAGTAAATCGAACATTTACTAACCAACAAGGCAATCGAGAAGCCGATTTTATCAATTGTGTGGCTT
GGAGAAATCAAGCGGAAAACGTCGCAAACTTTCTTAAAAAGGGAAGCCTTGCTGGTGTAGATGGACGTTTGCAAACGAGG
AGCTATGATAATCAAGAGGGTCAACGTGTCTTTGTAACGGAAGTACAAGCTGAAAGGGTTCAGTTCCTTGAGCCAAAAGG
CAATGGTGCTGGATCTGGCGGTGGACAAAATGTTCCGGATTCACTCGGCAGCGAGCAGAGTGATTTTAATTTAAGAAGCA
GCTTTAATGACAGTGACGATCCATTTGCAAATAACGGAAAATCAATTGATATCTCGGATGATGATTTGCCATTTTAA

Domains

Predicted by InterproScan.

Single-strand binding protein family (SSB)

(2-103)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssbA Bacillus subtilis subsp. subtilis str. 168

69.54

100

0.766
  ssb Latilactobacillus sakei subsp. sakei 23K

58.824

100

0.633
  ssbB Bacillus subtilis subsp. subtilis str. 168

60.377

67.089

0.405

Multiple sequence alignment