Detailed information    

insolico Bioinformatically predicted

Overview


Name   comB7   Type   Machinery gene
Locus tag   SPH25_RS06405 Genome accession   NZ_CP140484
Coordinates   1335677..1335802 (-) Length   41 a.a.
NCBI ID   WP_001217874.1    Uniprot ID   A0AAI7ZWZ6
Organism   Helicobacter pylori strain 52N     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 1330677..1340802
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  SPH25_RS06385 - 1331370..1332782 (-) 1413 WP_000694850.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -
  SPH25_RS06390 comB10 1332852..1333988 (-) 1137 WP_001045779.1 DNA type IV secretion system protein ComB10 Machinery gene
  SPH25_RS06395 comB9 1333981..1334943 (-) 963 WP_014533534.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  SPH25_RS06400 comB8 1334943..1335680 (-) 738 WP_000660526.1 virB8 family protein Machinery gene
  SPH25_RS06405 comB7 1335677..1335802 (-) 126 WP_001217874.1 hypothetical protein Machinery gene
  SPH25_RS06410 comB6 1335818..1336873 (-) 1056 WP_000786672.1 P-type conjugative transfer protein TrbL Machinery gene
  SPH25_RS06415 - 1336881..1337876 (-) 996 WP_000468447.1 PDZ domain-containing protein -
  SPH25_RS06420 - 1337876..1338169 (-) 294 WP_000347922.1 YbaB/EbfC family nucleoid-associated protein -
  SPH25_RS06425 panD 1338180..1338530 (-) 351 WP_000142205.1 aspartate 1-decarboxylase -
  SPH25_RS06430 - 1338520..1340745 (-) 2226 WP_001051539.1 ATP-dependent Clp protease ATP-binding subunit -

Sequence


Protein


Download         Length: 41 a.a.        Molecular weight: 4798.82 Da        Isoelectric Point: 9.3278

>NTDB_id=914470 SPH25_RS06405 WP_001217874.1 1335677..1335802(-) (comB7) [Helicobacter pylori strain 52N]
MRIFFVIMGLVLFGCTSKVHEMKKSPCTLHEKLYENRLNLA

Nucleotide


Download         Length: 126 bp        

>NTDB_id=914470 SPH25_RS06405 WP_001217874.1 1335677..1335802(-) (comB7) [Helicobacter pylori strain 52N]
ATGAGAATTTTTTTTGTCATTATGGGACTAGTATTGTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACATTGCATGAAAAGTTATATGAAAACAGGTTAAATCTTGCATGA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

87.805

100

0.878