Detailed information    

insolico Bioinformatically predicted

Overview

Name   comB7   Type   Machinery gene
Locus tag   SPG78_RS06565 Genome accession   NZ_CP140483
Coordinates   1353329..1353454 (-) Length   41 a.a.
NCBI ID   WP_001217874.1    Uniprot ID   A0AAI7ZWZ6
Organism   Helicobacter pylori strain 51N     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 1348329..1358454
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  SPG78_RS06545 - 1349013..1350425 (-) 1413 WP_000694858.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -
  SPG78_RS06550 comB10 1350495..1351631 (-) 1137 WP_001045729.1 DNA type IV secretion system protein ComB10 Machinery gene
  SPG78_RS06555 comB9 1351624..1352589 (-) 966 WP_014537399.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  SPG78_RS06560 comB8 1352589..1353332 (-) 744 WP_000660524.1 virB8 family protein Machinery gene
  SPG78_RS06565 comB7 1353329..1353454 (-) 126 WP_001217874.1 hypothetical protein Machinery gene
  SPG78_RS06570 comB6 1353470..1354525 (-) 1056 WP_000786701.1 P-type conjugative transfer protein TrbL Machinery gene
  SPG78_RS06575 - 1354533..1355528 (-) 996 WP_000468804.1 PDZ domain-containing protein -
  SPG78_RS06580 - 1355528..1355821 (-) 294 WP_000347922.1 YbaB/EbfC family nucleoid-associated protein -
  SPG78_RS06585 panD 1355832..1356182 (-) 351 WP_000142208.1 aspartate 1-decarboxylase -
  SPG78_RS06590 - 1356172..1358394 (-) 2223 WP_001051520.1 ATP-dependent Clp protease ATP-binding subunit -

Sequence

Protein


Download         Length: 41 a.a.        Molecular weight: 4798.82 Da        Isoelectric Point: 9.3278

>NTDB_id=914450 SPG78_RS06565 WP_001217874.1 1353329..1353454(-) (comB7) [Helicobacter pylori strain 51N]
MRIFFVIMGLVLFGCTSKVHEMKKSPCTLHEKLYENRLNLA

Nucleotide


Download         Length: 126 bp        

>NTDB_id=914450 SPG78_RS06565 WP_001217874.1 1353329..1353454(-) (comB7) [Helicobacter pylori strain 51N]
ATGAGAATTTTTTTTGTCATTATGGGACTAGTATTGTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACATTGCATGAAAAGTTATATGAAAACAGGTTGAATCTTGCATGA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

87.805

100

0.878