Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssb   Type   Machinery gene
Locus tag   U2S90_RS16790 Genome accession   NZ_CP140441
Coordinates   3551585..3552109 (+) Length   174 a.a.
NCBI ID   WP_004249162.1    Uniprot ID   A0A1Z1SRL1
Organism   Proteus mirabilis strain 2023CK-01118     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 3500554..3553781 3551585..3552109 within 0


Gene organization within MGE regions


Location: 3500554..3553781
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  U2S90_RS16530 (U2S90_16520) - 3500554..3502200 (-) 1647 WP_196549807.1 hypothetical protein -
  U2S90_RS16535 (U2S90_16525) - 3502187..3502747 (-) 561 WP_036908741.1 hypothetical protein -
  U2S90_RS16540 (U2S90_16530) - 3502758..3503480 (-) 723 WP_213556050.1 hypothetical protein -
  U2S90_RS16545 (U2S90_16535) - 3503502..3505487 (-) 1986 WP_213556052.1 phage tail protein -
  U2S90_RS16550 (U2S90_16540) - 3505491..3506048 (-) 558 WP_049212312.1 phage tail protein -
  U2S90_RS16555 (U2S90_16545) - 3506041..3507225 (-) 1185 WP_213556053.1 baseplate J/gp47 family protein -
  U2S90_RS16560 (U2S90_16550) - 3507215..3507550 (-) 336 WP_049219617.1 DUF2590 family protein -
  U2S90_RS16565 (U2S90_16555) - 3507561..3510077 (-) 2517 WP_141060551.1 phage tail tape measure protein -
  U2S90_RS16570 - 3510077..3510220 (-) 144 WP_165544879.1 DUF6890 family protein -
  U2S90_RS16575 (U2S90_16560) - 3510265..3510534 (-) 270 WP_049220759.1 putative phage tail assembly chaperone -
  U2S90_RS16580 (U2S90_16570) - 3510643..3511017 (-) 375 WP_212637496.1 hypothetical protein -
  U2S90_RS16585 (U2S90_16575) - 3511014..3511439 (-) 426 WP_071233399.1 structural protein -
  U2S90_RS16590 (U2S90_16580) - 3511436..3511729 (-) 294 WP_036907276.1 phage holin family protein -
  U2S90_RS16595 (U2S90_16585) - 3511744..3512196 (-) 453 WP_036907273.1 DUF2597 family protein -
  U2S90_RS16600 (U2S90_16590) - 3512196..3513314 (-) 1119 WP_213556055.1 DUF2586 domain-containing protein -
  U2S90_RS16605 (U2S90_16595) - 3513329..3514027 (-) 699 WP_135023809.1 hypothetical protein -
  U2S90_RS16610 (U2S90_16600) - 3514024..3514512 (-) 489 WP_151252990.1 phage tail protein -
  U2S90_RS16615 (U2S90_16605) - 3514509..3514961 (-) 453 WP_036907264.1 head completion/stabilization protein -
  U2S90_RS16620 (U2S90_16610) gpM 3515296..3516000 (-) 705 WP_049212293.1 phage terminase small subunit -
  U2S90_RS16625 (U2S90_16615) - 3516006..3517037 (-) 1032 WP_036907256.1 phage major capsid protein, P2 family -
  U2S90_RS16630 (U2S90_16620) - 3517048..3517884 (-) 837 WP_212637495.1 GPO family capsid scaffolding protein -
  U2S90_RS16635 (U2S90_16625) - 3518046..3519833 (+) 1788 WP_036907251.1 terminase large subunit domain-containing protein -
  U2S90_RS16640 (U2S90_16630) - 3519833..3520867 (+) 1035 WP_174815125.1 phage portal protein -
  U2S90_RS16645 (U2S90_16635) - 3520864..3521172 (+) 309 WP_036907246.1 ogr/Delta-like zinc finger family protein -
  U2S90_RS16650 (U2S90_16640) - 3521174..3521356 (-) 183 WP_151252989.1 hypothetical protein -
  U2S90_RS16655 (U2S90_16645) - 3521675..3523867 (-) 2193 WP_213556059.1 replication endonuclease -
  U2S90_RS16660 (U2S90_16650) - 3523869..3524120 (-) 252 WP_036907235.1 DUF2732 family protein -
  U2S90_RS16665 (U2S90_16655) - 3524197..3524544 (-) 348 WP_049219058.1 DUF5347 domain-containing protein -
  U2S90_RS16670 (U2S90_16660) - 3524556..3524888 (-) 333 WP_152118365.1 hypothetical protein -
  U2S90_RS16675 (U2S90_16665) - 3525048..3525557 (-) 510 WP_196557380.1 phage regulatory CII family protein -
  U2S90_RS16680 (U2S90_16670) - 3525587..3525811 (-) 225 WP_036907225.1 AlpA family transcriptional regulator -
  U2S90_RS16685 (U2S90_16675) - 3525961..3526551 (+) 591 WP_052124619.1 phage repressor protein CI -
  U2S90_RS16690 (U2S90_16680) - 3526566..3526988 (+) 423 WP_036907222.1 hypothetical protein -
  U2S90_RS16695 (U2S90_16685) - 3526993..3528024 (+) 1032 WP_088206997.1 tyrosine-type recombinase/integrase -
  U2S90_RS16700 (U2S90_16690) - 3528118..3529494 (+) 1377 WP_283812195.1 fimbria/pilus outer membrane usher protein -
  U2S90_RS16705 (U2S90_16695) - 3529494..3530012 (+) 519 WP_004245882.1 fimbrial protein -
  U2S90_RS16710 (U2S90_16700) - 3530012..3531085 (+) 1074 WP_142836765.1 fimbrial protein -
  U2S90_RS16715 (U2S90_16705) - 3531112..3531429 (+) 318 WP_004245886.1 helix-turn-helix domain-containing protein -
  U2S90_RS16720 (U2S90_16710) potD 3531563..3532606 (-) 1044 WP_004245887.1 spermidine/putrescine ABC transporter substrate-binding protein PotD -
  U2S90_RS16725 (U2S90_16715) potC 3532723..3533502 (-) 780 WP_004245888.1 spermidine/putrescine ABC transporter permease PotC -
  U2S90_RS16730 (U2S90_16720) potB 3533499..3534359 (-) 861 WP_004250112.1 spermidine/putrescine ABC transporter permease PotB -
  U2S90_RS16735 (U2S90_16725) potA 3534343..3535458 (-) 1116 WP_004245891.1 spermidine/putrescine ABC transporter ATP-binding protein PotA -
  U2S90_RS16740 (U2S90_16730) - 3535902..3537176 (-) 1275 WP_004249170.1 S8 family peptidase -
  U2S90_RS16745 (U2S90_16735) - 3537402..3538466 (-) 1065 WP_017628493.1 Abi family protein -
  U2S90_RS16750 (U2S90_16740) dusA 3538899..3539933 (+) 1035 WP_004245894.1 tRNA dihydrouridine(20/20a) synthase DusA -
  U2S90_RS16755 (U2S90_16745) - 3540040..3541023 (-) 984 WP_004245895.1 NADPH:quinone reductase -
  U2S90_RS16760 (U2S90_16750) dnaB 3541191..3542600 (+) 1410 WP_004245896.1 replicative DNA helicase -
  U2S90_RS16765 (U2S90_16755) alr 3542641..3543732 (+) 1092 WP_004245898.1 alanine racemase -
  U2S90_RS16770 (U2S90_16760) - 3543788..3544981 (+) 1194 WP_012368490.1 amino acid aminotransferase -
  U2S90_RS16775 (U2S90_16765) - 3545103..3546452 (-) 1350 WP_004245900.1 serine dehydratase subunit alpha family protein -
  U2S90_RS16780 (U2S90_16770) - 3546514..3547845 (-) 1332 WP_004249166.1 amino acid permease -
  U2S90_RS16785 (U2S90_16775) uvrA 3548498..3551332 (-) 2835 WP_004249165.1 excinuclease ABC subunit UvrA -
  U2S90_RS16790 (U2S90_16780) ssb 3551585..3552109 (+) 525 WP_004249162.1 single-stranded DNA-binding protein SSB1 Machinery gene
  U2S90_RS16795 (U2S90_16785) zur 3552451..3552981 (+) 531 WP_004245904.1 zinc uptake transcriptional repressor Zur -
  U2S90_RS16800 (U2S90_16790) lexA 3553170..3553781 (-) 612 WP_004245906.1 transcriptional repressor LexA -

Sequence


Protein


Download         Length: 174 a.a.        Molecular weight: 18830.90 Da        Isoelectric Point: 4.9468

>NTDB_id=914381 U2S90_RS16790 WP_004249162.1 3551585..3552109(+) (ssb) [Proteus mirabilis strain 2023CK-01118]
MASRGVNKVILIGNLGQDPEIRYMPSGGAVANLTLATSESWRDKQTGEMKEKTEWHRVVIFGKLAEIAGEYLRKGSQVYI
EGQLQTRKWQDQSGQDRYSTEVVVNIGGTMQMLGGRGGQDNAPSQGQGGWGQPQQPQASQQFSGGAPSRPAQQPAAAPAP
SNEPPMDFDDDIPF

Nucleotide


Download         Length: 525 bp        

>NTDB_id=914381 U2S90_RS16790 WP_004249162.1 3551585..3552109(+) (ssb) [Proteus mirabilis strain 2023CK-01118]
ATGGCGAGCAGAGGCGTTAACAAAGTTATTCTTATCGGTAATTTAGGGCAGGATCCAGAAATCCGTTATATGCCAAGTGG
TGGTGCAGTGGCAAATCTGACACTAGCAACTTCAGAAAGCTGGCGCGACAAACAAACCGGTGAAATGAAAGAGAAAACCG
AATGGCACCGTGTGGTCATTTTCGGCAAACTAGCAGAAATTGCTGGCGAGTATCTGCGCAAAGGTTCACAAGTTTATATT
GAAGGTCAATTACAAACACGTAAATGGCAAGATCAAAGTGGTCAAGATCGCTACAGCACTGAAGTTGTGGTGAATATCGG
TGGCACAATGCAGATGTTAGGTGGCCGTGGTGGTCAAGATAATGCACCTTCACAAGGCCAAGGCGGTTGGGGTCAACCTC
AGCAACCACAAGCATCACAACAGTTTAGTGGTGGCGCACCATCTCGCCCAGCACAACAACCCGCAGCGGCACCAGCGCCA
AGTAATGAACCACCAATGGACTTTGATGACGATATTCCGTTCTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A1Z1SRL1

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Vibrio cholerae strain A1552

71.892

100

0.764

  ssb Glaesserella parasuis strain SC1401

57.065

100

0.603

  ssb Neisseria meningitidis MC58

48.023

100

0.489

  ssb Neisseria gonorrhoeae MS11

48.023

100

0.489