Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssb   Type   Machinery gene
Locus tag   U0544_RS01640 Genome accession   NZ_CP139944
Coordinates   217077..217430 (+) Length   117 a.a.
NCBI ID   WP_326938879.1    Uniprot ID   -
Organism   Acinetobacter pittii strain CARB128     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 187449..219795 217077..217430 within 0


Gene organization within MGE regions


Location: 187449..219795
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  U0544_RS01445 (U0544_01445) - 187449..188456 (-) 1008 WP_326938869.1 phage portal protein -
  U0544_RS01450 (U0544_01450) - 188457..190241 (-) 1785 WP_326938870.1 terminase large subunit domain-containing protein -
  U0544_RS01455 (U0544_01455) - 190398..191201 (+) 804 WP_135536647.1 GPO family capsid scaffolding protein -
  U0544_RS01460 (U0544_01460) - 191216..192205 (+) 990 WP_326938871.1 phage major capsid protein, P2 family -
  U0544_RS01465 (U0544_01465) gpM 192216..192980 (+) 765 WP_032006096.1 phage terminase small subunit -
  U0544_RS01470 (U0544_01470) - 193083..193535 (+) 453 WP_326938872.1 head completion/stabilization protein -
  U0544_RS01475 (U0544_01475) - 193536..193745 (+) 210 WP_151299118.1 tail protein X -
  U0544_RS01480 (U0544_01480) - 193754..194104 (+) 351 WP_001114936.1 putative holin -
  U0544_RS01485 (U0544_01485) - 194101..194370 (+) 270 WP_000571491.1 phage holin family protein -
  U0544_RS01490 (U0544_01490) - 194367..195197 (+) 831 WP_002056047.1 N-acetylmuramidase domain-containing protein -
  U0544_RS01495 (U0544_01495) - 195194..195721 (+) 528 WP_326938873.1 phage tail protein -
  U0544_RS01500 (U0544_01500) - 195718..196167 (+) 450 WP_320148350.1 phage virion morphogenesis protein -
  U0544_RS01505 (U0544_01505) - 196240..196866 (+) 627 WP_326938874.1 phage baseplate assembly protein V -
  U0544_RS01510 (U0544_01510) - 196863..197210 (+) 348 WP_032014595.1 GPW/gp25 family protein -
  U0544_RS01515 (U0544_01515) - 197207..198109 (+) 903 WP_032014598.1 baseplate J/gp47 family protein -
  U0544_RS01520 (U0544_01520) - 198109..198714 (+) 606 WP_086221961.1 phage tail protein I -
  U0544_RS01525 (U0544_01525) - 198726..201194 (+) 2469 WP_326938875.1 phage tail protein -
  U0544_RS01530 (U0544_01530) - 201208..201840 (+) 633 WP_032014606.1 tail fiber domain-containing protein -
  U0544_RS01535 (U0544_01535) - 201931..203106 (+) 1176 WP_326938876.1 phage tail sheath protein -
  U0544_RS01540 (U0544_01540) - 203119..203637 (+) 519 WP_001207611.1 phage major tail tube protein -
  U0544_RS01545 (U0544_01545) - 203704..204045 (+) 342 WP_326938877.1 phage tail assembly protein -
  U0544_RS01550 (U0544_01550) - 204081..204185 (+) 105 WP_227555080.1 GpE family phage tail protein -
  U0544_RS01555 (U0544_01555) - 204199..206649 (+) 2451 WP_326938878.1 phage tail tape measure protein -
  U0544_RS01560 (U0544_01560) - 206655..207095 (+) 441 WP_000979754.1 phage tail protein -
  U0544_RS01565 (U0544_01565) - 207096..208410 (+) 1315 Protein_225 DNA primase -
  U0544_RS01570 (U0544_01570) - 208541..208780 (+) 240 WP_000113727.1 ogr/Delta-like zinc finger family protein -
  U0544_RS01575 (U0544_01575) - 208777..208977 (+) 201 WP_000130087.1 TraR/DksA C4-type zinc finger protein -
  U0544_RS01580 (U0544_01580) - 209288..210034 (-) 747 WP_111937015.1 hypothetical protein -
  U0544_RS01585 (U0544_01585) - 210106..210840 (-) 735 WP_000190074.1 hypothetical protein -
  U0544_RS01590 (U0544_01590) - 211156..211350 (+) 195 WP_002001330.1 hypothetical protein -
  U0544_RS01595 (U0544_01595) - 211353..211598 (+) 246 WP_000789360.1 hypothetical protein -
  U0544_RS01600 (U0544_01600) - 211699..211914 (+) 216 WP_000556347.1 hypothetical protein -
  U0544_RS01605 (U0544_01605) - 211959..212300 (-) 342 WP_000786717.1 helix-turn-helix domain-containing protein -
  U0544_RS01610 (U0544_01610) - 212393..212584 (+) 192 WP_001043481.1 hypothetical protein -
  U0544_RS01615 (U0544_01615) - 212678..215416 (+) 2739 WP_025464780.1 toprim domain-containing protein -
  U0544_RS01620 (U0544_01620) - 215413..215748 (+) 336 WP_057097136.1 hypothetical protein -
  U0544_RS01625 (U0544_01625) - 215816..216247 (+) 432 WP_001178667.1 DUF2528 family protein -
  U0544_RS01630 (U0544_01630) - 216250..216768 (+) 519 WP_000877796.1 hypothetical protein -
  U0544_RS01635 (U0544_01635) - 216772..217089 (+) 318 WP_000049862.1 hypothetical protein -
  U0544_RS01640 (U0544_01640) ssb 217077..217430 (+) 354 WP_326938879.1 single-stranded DNA-binding protein Machinery gene
  U0544_RS01645 (U0544_01645) - 217440..218177 (+) 738 WP_000125746.1 3'-5' exonuclease -
  U0544_RS01650 (U0544_01650) - 218186..218407 (+) 222 WP_005136253.1 hypothetical protein -
  U0544_RS01655 (U0544_01655) - 218404..218700 (+) 297 WP_000218943.1 hypothetical protein -
  U0544_RS01660 (U0544_01660) - 218728..219795 (-) 1068 WP_000107856.1 tyrosine-type recombinase/integrase -

Sequence


Protein


Download         Length: 117 a.a.        Molecular weight: 13305.02 Da        Isoelectric Point: 9.7939

>NTDB_id=911895 U0544_RS01640 WP_326938879.1 217077..217430(+) (ssb) [Acinetobacter pittii strain CARB128]
MRGINKVILVGVLGANPIPKQFQNGGSYAQFSIATSEKYQDKRTGDWIENTEWHRIVAHNRLGEIACQFLKKGSKVYIEG
SLHTRKWTDQNNQDRYVTEVRAITFQSLDSVPQANPV

Nucleotide


Download         Length: 354 bp        

>NTDB_id=911895 U0544_RS01640 WP_326938879.1 217077..217430(+) (ssb) [Acinetobacter pittii strain CARB128]
ATGCGCGGAATAAACAAAGTGATATTGGTCGGTGTGCTTGGTGCCAATCCAATTCCTAAACAGTTTCAAAACGGTGGCTC
CTATGCTCAGTTTTCAATTGCCACTTCAGAAAAATACCAGGACAAACGAACTGGTGACTGGATTGAAAATACAGAGTGGC
ATCGTATTGTTGCCCACAACAGACTAGGAGAAATTGCCTGCCAATTTCTTAAAAAAGGTTCAAAAGTTTATATCGAAGGG
TCATTACATACACGGAAATGGACTGACCAAAACAATCAAGACCGTTACGTAACTGAAGTTAGAGCCATTACTTTTCAATC
GCTCGATAGCGTGCCACAAGCAAACCCGGTTTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Glaesserella parasuis strain SC1401

56.364

94.017

0.53

  ssb Vibrio cholerae strain A1552

55.556

84.615

0.47

  ssb Neisseria gonorrhoeae MS11

41.905

89.744

0.376

  ssb Neisseria meningitidis MC58

41.905

89.744

0.376