Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | OCU49_RS12895 | Genome accession | NZ_AP025282 |
| Coordinates | 2817754..2818245 (+) | Length | 163 a.a. |
| NCBI ID | WP_261840983.1 | Uniprot ID | - |
| Organism | Aliamphritea ceti strain KCTC 42154 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2782276..2821734 | 2817754..2818245 | within | 0 |
Gene organization within MGE regions
Location: 2782276..2821734
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OCU49_RS12675 | - | 2782276..2783013 (-) | 738 | WP_261840939.1 | hypothetical protein | - |
| OCU49_RS12680 | - | 2783026..2783790 (-) | 765 | WP_261840940.1 | hypothetical protein | - |
| OCU49_RS12685 | - | 2783799..2784383 (-) | 585 | WP_261840941.1 | YmfQ family protein | - |
| OCU49_RS12690 | - | 2784374..2785441 (-) | 1068 | WP_261840942.1 | baseplate J/gp47 family protein | - |
| OCU49_RS12695 | - | 2785445..2785849 (-) | 405 | WP_261840943.1 | phage GP46 family protein | - |
| OCU49_RS12700 | - | 2785846..2786376 (-) | 531 | WP_261840944.1 | phage baseplate assembly protein | - |
| OCU49_RS12705 | - | 2786391..2787488 (-) | 1098 | WP_261840945.1 | phage baseplate assembly protein | - |
| OCU49_RS12710 | - | 2787481..2788608 (-) | 1128 | WP_261840946.1 | DNA circularization protein | - |
| OCU49_RS12715 | - | 2788681..2789169 (-) | 489 | WP_261840947.1 | SHOCT domain-containing protein | - |
| OCU49_RS12720 | - | 2789271..2790896 (-) | 1626 | WP_261840948.1 | hypothetical protein | - |
| OCU49_RS12725 | - | 2791014..2791313 (-) | 300 | WP_261840949.1 | phage tail assembly protein | - |
| OCU49_RS12730 | - | 2791313..2791678 (-) | 366 | WP_261840950.1 | phage tail tube protein | - |
| OCU49_RS12735 | - | 2791691..2793151 (-) | 1461 | WP_261840951.1 | phage tail sheath subtilisin-like domain-containing protein | - |
| OCU49_RS12740 | - | 2793320..2794180 (-) | 861 | WP_261840952.1 | hypothetical protein | - |
| OCU49_RS12745 | - | 2794177..2794605 (-) | 429 | WP_261840953.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| OCU49_RS12750 | - | 2794598..2794918 (-) | 321 | WP_261840954.1 | phage head closure protein | - |
| OCU49_RS12755 | - | 2794920..2795480 (-) | 561 | WP_261840955.1 | head-tail connector protein | - |
| OCU49_RS12760 | - | 2795551..2795754 (-) | 204 | WP_261840956.1 | hypothetical protein | - |
| OCU49_RS12765 | - | 2795820..2797100 (-) | 1281 | WP_261840957.1 | phage major capsid protein | - |
| OCU49_RS12770 | - | 2797179..2798138 (-) | 960 | WP_261840958.1 | S49 family peptidase | - |
| OCU49_RS12775 | - | 2798126..2799412 (-) | 1287 | WP_261840959.1 | phage portal protein | - |
| OCU49_RS12780 | - | 2799416..2799595 (-) | 180 | WP_261840960.1 | hypothetical protein | - |
| OCU49_RS12785 | - | 2799589..2801310 (-) | 1722 | WP_261840961.1 | terminase large subunit | - |
| OCU49_RS12790 | - | 2801314..2801790 (-) | 477 | WP_261840962.1 | phage terminase small subunit P27 family | - |
| OCU49_RS12795 | - | 2801897..2802265 (-) | 369 | WP_261840963.1 | HNH endonuclease | - |
| OCU49_RS12800 | - | 2802270..2802731 (-) | 462 | WP_376787875.1 | DUF1353 domain-containing protein | - |
| OCU49_RS12805 | - | 2802948..2803247 (-) | 300 | WP_261840965.1 | hypothetical protein | - |
| OCU49_RS12810 | - | 2803240..2803842 (-) | 603 | WP_261840966.1 | hypothetical protein | - |
| OCU49_RS12815 | - | 2804123..2805919 (+) | 1797 | WP_261840967.1 | DUF4097 domain-containing protein | - |
| OCU49_RS12820 | - | 2805933..2807192 (-) | 1260 | WP_261840968.1 | Y-family DNA polymerase | - |
| OCU49_RS12825 | - | 2807192..2807596 (-) | 405 | WP_261840969.1 | S24 family peptidase | - |
| OCU49_RS12830 | - | 2807799..2808866 (-) | 1068 | WP_261840970.1 | putative phage abortive infection protein | - |
| OCU49_RS12835 | - | 2808976..2809398 (-) | 423 | WP_261840971.1 | hypothetical protein | - |
| OCU49_RS12840 | - | 2809435..2810400 (+) | 966 | WP_261840972.1 | IS5 family transposase | - |
| OCU49_RS12845 | - | 2810748..2811212 (-) | 465 | WP_261840973.1 | hypothetical protein | - |
| OCU49_RS12850 | - | 2811231..2811671 (-) | 441 | WP_261840974.1 | hypothetical protein | - |
| OCU49_RS12855 | - | 2811682..2812764 (-) | 1083 | WP_261840975.1 | DnaT-like ssDNA-binding domain-containing protein | - |
| OCU49_RS12860 | - | 2813818..2814012 (-) | 195 | WP_261840976.1 | hypothetical protein | - |
| OCU49_RS12865 | - | 2814107..2814763 (+) | 657 | WP_261840977.1 | S24 family peptidase | - |
| OCU49_RS12870 | - | 2814827..2815411 (+) | 585 | WP_376787876.1 | DUF6932 family protein | - |
| OCU49_RS12875 | - | 2815401..2816321 (+) | 921 | WP_261840979.1 | hypothetical protein | - |
| OCU49_RS12880 | - | 2816662..2817174 (+) | 513 | WP_261840980.1 | helix-turn-helix transcriptional regulator | - |
| OCU49_RS12885 | - | 2817171..2817476 (+) | 306 | WP_261840981.1 | hypothetical protein | - |
| OCU49_RS12890 | - | 2817483..2817743 (+) | 261 | WP_261840982.1 | hypothetical protein | - |
| OCU49_RS12895 | ssb | 2817754..2818245 (+) | 492 | WP_261840983.1 | single-stranded DNA-binding protein | Machinery gene |
| OCU49_RS12900 | - | 2818318..2818665 (+) | 348 | WP_261840984.1 | hypothetical protein | - |
| OCU49_RS12905 | - | 2818702..2819517 (+) | 816 | WP_261840985.1 | YfdQ family protein | - |
| OCU49_RS12910 | - | 2819586..2820533 (+) | 948 | WP_261840986.1 | DNA cytosine methyltransferase | - |
| OCU49_RS12915 | - | 2820520..2820738 (+) | 219 | WP_261840987.1 | DUF4224 domain-containing protein | - |
| OCU49_RS12920 | - | 2820745..2821734 (+) | 990 | WP_261840988.1 | site-specific integrase | - |
Sequence
Protein
Download Length: 163 a.a. Molecular weight: 18269.22 Da Isoelectric Point: 4.9746
>NTDB_id=91020 OCU49_RS12895 WP_261840983.1 2817754..2818245(+) (ssb) [Aliamphritea ceti strain KCTC 42154]
MARGINKVILIGNLGNDPDTKYLPSGNAVTNITIATSESWKDKQTGQMQERTEWHRVVFFNRLAEIAGEYLRKGSKVYIE
GSLRTRKWKDQAGQDRYTTEIIASELQMLDVRTDNSNSPPQSPAQQQTNAPQQTSQPAPAPSSDDFDDDIPFANPYKGCE
YTV
MARGINKVILIGNLGNDPDTKYLPSGNAVTNITIATSESWKDKQTGQMQERTEWHRVVFFNRLAEIAGEYLRKGSKVYIE
GSLRTRKWKDQAGQDRYTTEIIASELQMLDVRTDNSNSPPQSPAQQQTNAPQQTSQPAPAPSSDDFDDDIPFANPYKGCE
YTV
Nucleotide
Download Length: 492 bp
>NTDB_id=91020 OCU49_RS12895 WP_261840983.1 2817754..2818245(+) (ssb) [Aliamphritea ceti strain KCTC 42154]
ATGGCACGCGGCATTAACAAAGTCATTCTGATCGGCAACCTGGGCAATGACCCGGACACTAAATACCTACCCAGCGGCAA
TGCTGTGACAAACATCACAATTGCCACCTCAGAAAGCTGGAAGGACAAGCAAACCGGCCAGATGCAGGAACGGACCGAAT
GGCACCGCGTCGTTTTCTTTAACCGACTGGCTGAGATTGCCGGCGAATATCTTCGCAAAGGCTCAAAGGTATATATCGAG
GGCTCACTCAGAACCCGTAAATGGAAAGATCAGGCCGGCCAAGACCGTTACACCACTGAAATCATCGCCAGCGAACTGCA
GATGCTAGATGTCCGTACTGATAACAGTAACTCGCCGCCTCAATCACCAGCACAACAGCAAACAAACGCGCCACAGCAGA
CATCACAACCTGCACCCGCGCCAAGCTCTGATGATTTCGATGATGATATCCCGTTCGCGAATCCCTACAAGGGGTGCGAA
TACACCGTGTAA
ATGGCACGCGGCATTAACAAAGTCATTCTGATCGGCAACCTGGGCAATGACCCGGACACTAAATACCTACCCAGCGGCAA
TGCTGTGACAAACATCACAATTGCCACCTCAGAAAGCTGGAAGGACAAGCAAACCGGCCAGATGCAGGAACGGACCGAAT
GGCACCGCGTCGTTTTCTTTAACCGACTGGCTGAGATTGCCGGCGAATATCTTCGCAAAGGCTCAAAGGTATATATCGAG
GGCTCACTCAGAACCCGTAAATGGAAAGATCAGGCCGGCCAAGACCGTTACACCACTGAAATCATCGCCAGCGAACTGCA
GATGCTAGATGTCCGTACTGATAACAGTAACTCGCCGCCTCAATCACCAGCACAACAGCAAACAAACGCGCCACAGCAGA
CATCACAACCTGCACCCGCGCCAAGCTCTGATGATTTCGATGATGATATCCCGTTCGCGAATCCCTACAAGGGGTGCGAA
TACACCGTGTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Vibrio cholerae strain A1552 |
55.429 |
100 |
0.595 |
| ssb | Glaesserella parasuis strain SC1401 |
51.685 |
100 |
0.564 |
| ssb | Neisseria gonorrhoeae MS11 |
43.931 |
100 |
0.466 |
| ssb | Neisseria meningitidis MC58 |
43.678 |
100 |
0.466 |