Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssb   Type   Machinery gene
Locus tag   SR933_RS04290 Genome accession   NZ_CP139472
Coordinates   876758..877267 (+) Length   169 a.a.
NCBI ID   WP_013331866.1    Uniprot ID   E1VAE8
Organism   Halomonas elongata DSM 2581 strain ATCC 33173     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 845688..885068 876758..877267 within 0


Gene organization within MGE regions


Location: 845688..885068
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  SR933_RS04040 (SR933_04040) - 845688..846050 (-) 363 WP_013331832.1 hypothetical protein -
  SR933_RS04045 (SR933_04045) - 846060..848570 (-) 2511 WP_013331833.1 phage tail tape measure protein -
  SR933_RS04050 (SR933_04050) - 848659..848952 (-) 294 WP_041601943.1 hypothetical protein -
  SR933_RS04055 (SR933_04055) - 849101..849388 (+) 288 WP_013331834.1 type II toxin-antitoxin system HigB family toxin -
  SR933_RS04060 (SR933_04060) - 849392..849820 (+) 429 WP_013331835.1 type II toxin-antitoxin system HigA family antitoxin -
  SR933_RS04065 (SR933_04065) - 849894..850082 (-) 189 WP_013331836.1 hypothetical protein -
  SR933_RS04070 (SR933_04070) - 850190..850660 (-) 471 WP_013331837.1 hypothetical protein -
  SR933_RS04075 (SR933_04075) - 850670..851605 (-) 936 WP_013331838.1 phage tail tube protein -
  SR933_RS04080 (SR933_04080) - 851680..852057 (-) 378 WP_013331839.1 DUF4128 domain-containing protein -
  SR933_RS04085 (SR933_04085) - 852054..852443 (-) 390 WP_013331840.1 hypothetical protein -
  SR933_RS04090 (SR933_04090) - 852445..852825 (-) 381 WP_013331841.1 hypothetical protein -
  SR933_RS04095 (SR933_04095) - 852812..853216 (-) 405 WP_013331842.1 hypothetical protein -
  SR933_RS04100 (SR933_04100) - 853256..853489 (-) 234 WP_013331843.1 hypothetical protein -
  SR933_RS04105 (SR933_04105) - 853492..854457 (-) 966 WP_013331844.1 DUF2184 domain-containing protein -
  SR933_RS04110 (SR933_04110) - 854470..854883 (-) 414 WP_198410726.1 hypothetical protein -
  SR933_RS04115 (SR933_04115) - 854892..855998 (-) 1107 WP_013331846.1 DUF2213 domain-containing protein -
  SR933_RS04120 (SR933_04120) - 855995..856831 (-) 837 WP_013331847.1 phage minor head protein -
  SR933_RS04125 (SR933_04125) - 856824..858068 (-) 1245 WP_013331848.1 DUF1073 domain-containing protein -
  SR933_RS04130 (SR933_04130) - 858077..859672 (-) 1596 WP_013331849.1 hypothetical protein -
  SR933_RS04135 (SR933_04135) - 859672..860262 (-) 591 WP_013331850.1 terminase small subunit -
  SR933_RS04140 (SR933_04140) - 860892..861131 (-) 240 WP_041601944.1 hypothetical protein -
  SR933_RS04145 (SR933_04145) - 861142..861456 (-) 315 WP_157953394.1 hypothetical protein -
  SR933_RS04150 (SR933_04150) - 861453..862028 (-) 576 WP_041601946.1 glycoside hydrolase family 108 protein -
  SR933_RS04155 (SR933_04155) - 862338..862967 (-) 630 WP_013331852.1 hypothetical protein -
  SR933_RS04160 (SR933_04160) - 862960..863124 (-) 165 WP_157953395.1 hypothetical protein -
  SR933_RS04165 (SR933_04165) - 863139..863537 (-) 399 WP_157953396.1 hypothetical protein -
  SR933_RS04170 (SR933_04170) - 863534..863968 (-) 435 WP_013331854.1 DUF968 domain-containing protein -
  SR933_RS04175 (SR933_04175) - 863965..864162 (-) 198 WP_041601948.1 hypothetical protein -
  SR933_RS04180 (SR933_04180) - 864159..864665 (-) 507 WP_013331855.1 hypothetical protein -
  SR933_RS04185 (SR933_04185) - 864662..865006 (-) 345 WP_041601949.1 hypothetical protein -
  SR933_RS04190 (SR933_04190) - 865003..865212 (-) 210 WP_013331856.1 hypothetical protein -
  SR933_RS04195 (SR933_04195) - 865209..865472 (-) 264 WP_041601950.1 hypothetical protein -
  SR933_RS04200 (SR933_04200) - 865469..866203 (-) 735 WP_013331857.1 hypothetical protein -
  SR933_RS04205 (SR933_04205) - 866207..867157 (-) 951 WP_013331858.1 helix-turn-helix domain-containing protein -
  SR933_RS04210 (SR933_04210) - 867154..867942 (-) 789 WP_013331859.1 BRO family protein -
  SR933_RS04215 (SR933_04215) - 868016..868474 (-) 459 WP_013331860.1 phage regulatory CII family protein -
  SR933_RS04220 (SR933_04220) - 868540..868737 (-) 198 WP_041601951.1 helix-turn-helix domain-containing protein -
  SR933_RS04225 (SR933_04225) - 868846..869538 (+) 693 WP_162301210.1 S24 family peptidase -
  SR933_RS04230 (SR933_04230) - 869611..870339 (+) 729 WP_174208840.1 zeta toxin family protein -
  SR933_RS04235 (SR933_04235) - 870345..870518 (+) 174 WP_174208841.1 hypothetical protein -
  SR933_RS04240 (SR933_04240) - 871568..871960 (+) 393 WP_041601952.1 hypothetical protein -
  SR933_RS04245 (SR933_04245) - 871957..872238 (-) 282 WP_041601953.1 hypothetical protein -
  SR933_RS04250 (SR933_04250) - 872488..872703 (+) 216 WP_049786195.1 hypothetical protein -
  SR933_RS04255 (SR933_04255) - 872715..872870 (+) 156 WP_157953397.1 hypothetical protein -
  SR933_RS04260 (SR933_04260) - 873157..873366 (+) 210 WP_041601955.1 hypothetical protein -
  SR933_RS04265 (SR933_04265) - 873371..873571 (+) 201 WP_013331862.1 hypothetical protein -
  SR933_RS04270 (SR933_04270) - 873568..873897 (+) 330 WP_041601956.1 hypothetical protein -
  SR933_RS04275 (SR933_04275) - 874112..874897 (+) 786 WP_013331863.1 Rad52/Rad22 family DNA repair protein -
  SR933_RS04280 (SR933_04280) - 874890..875774 (+) 885 WP_013331864.1 hypothetical protein -
  SR933_RS04285 (SR933_04285) - 875814..876749 (+) 936 WP_013331865.1 recombination-associated protein RdgC -
  SR933_RS04290 (SR933_04290) ssb 876758..877267 (+) 510 WP_013331866.1 single-stranded DNA-binding protein Machinery gene
  SR933_RS04295 (SR933_04295) - 877588..878178 (+) 591 WP_157953398.1 hypothetical protein -
  SR933_RS04300 (SR933_04300) - 878286..878585 (-) 300 WP_041601957.1 hypothetical protein -
  SR933_RS04305 (SR933_04305) - 878698..880269 (+) 1572 WP_013331867.1 DNA cytosine methyltransferase -
  SR933_RS04310 (SR933_04310) - 880266..880541 (+) 276 WP_041601958.1 hypothetical protein -
  SR933_RS04315 (SR933_04315) - 880538..881002 (+) 465 WP_013331868.1 hypothetical protein -
  SR933_RS04320 (SR933_04320) - 881073..881468 (+) 396 WP_013331869.1 hypothetical protein -
  SR933_RS04325 (SR933_04325) - 881461..881628 (+) 168 WP_157953399.1 hypothetical protein -
  SR933_RS04330 (SR933_04330) - 881801..882346 (+) 546 WP_013331870.1 HD domain-containing protein -
  SR933_RS04335 (SR933_04335) - 882410..882952 (+) 543 WP_013331871.1 HNH endonuclease -
  SR933_RS04340 (SR933_04340) - 882969..883193 (+) 225 WP_041601960.1 DUF4224 domain-containing protein -
  SR933_RS04345 (SR933_04345) - 883190..884200 (+) 1011 WP_013331872.1 tyrosine-type recombinase/integrase -
  SR933_RS04350 (SR933_04350) - 884286..885068 (+) 783 WP_013331873.1 class II glutamine amidotransferase -

Sequence


Protein


Download         Length: 169 a.a.        Molecular weight: 19196.27 Da        Isoelectric Point: 7.2021

>NTDB_id=909916 SR933_RS04290 WP_013331866.1 876758..877267(+) (ssb) [Halomonas elongata DSM 2581 strain ATCC 33173]
MARGINKVILIGNVGQDPEIRFTQSGTPVGNINLATSDTWTDKQSGQRQERTEWHRLIVFRRLAEVAQQYVRKGSKLYVE
GRLQTRKWQDQSGQDRYVTEIIVNDLQMLDSRQGQPQGNAQAQQQPSQNGYFDQQRQYQQQQTAPPNPPGGGDFDDEIPF
APMHPLMGG

Nucleotide


Download         Length: 510 bp        

>NTDB_id=909916 SR933_RS04290 WP_013331866.1 876758..877267(+) (ssb) [Halomonas elongata DSM 2581 strain ATCC 33173]
ATGGCCCGAGGCATCAACAAGGTCATCCTGATCGGCAACGTCGGCCAGGATCCCGAGATCCGCTTTACCCAGTCCGGTAC
GCCAGTCGGCAACATCAACCTCGCCACCAGTGACACCTGGACCGACAAGCAGAGCGGGCAGCGCCAGGAGCGCACGGAAT
GGCATCGCCTGATCGTCTTCCGCCGCCTTGCCGAGGTCGCGCAGCAGTACGTCCGCAAGGGATCGAAACTCTACGTCGAG
GGGCGACTGCAGACACGGAAGTGGCAAGACCAGAGCGGTCAGGATCGTTACGTCACGGAGATCATCGTCAACGATCTGCA
GATGCTCGACTCCCGGCAAGGGCAGCCACAGGGCAATGCCCAGGCTCAGCAGCAGCCCTCACAGAACGGCTACTTCGACC
AGCAACGGCAGTACCAGCAACAACAGACCGCGCCGCCGAATCCTCCTGGCGGGGGCGACTTCGACGACGAGATCCCATTC
GCTCCCATGCACCCGCTGATGGGCGGCTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB E1VAE8

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Vibrio cholerae strain A1552

50.847

100

0.533

  ssb Glaesserella parasuis strain SC1401

48.876

100

0.515

  ssb Neisseria meningitidis MC58

40.223

100

0.426

  ssb Neisseria gonorrhoeae MS11

40.223

100

0.426