Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | SH597_RS05685 | Genome accession | NZ_CP139216 |
| Coordinates | 1162145..1162585 (+) | Length | 146 a.a. |
| NCBI ID | WP_194854033.1 | Uniprot ID | - |
| Organism | Lacticaseibacillus paracasei strain A02 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1153976..1198872 | 1162145..1162585 | within | 0 |
Gene organization within MGE regions
Location: 1153976..1198872
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SH597_RS05605 (SH597_05605) | - | 1153976..1155160 (-) | 1185 | WP_194854024.1 | tyrosine-type recombinase/integrase | - |
| SH597_RS05610 (SH597_05610) | - | 1155250..1155453 (-) | 204 | WP_194854025.1 | hypothetical protein | - |
| SH597_RS05615 (SH597_05615) | - | 1155477..1155902 (-) | 426 | WP_194854026.1 | pyridoxamine 5'-phosphate oxidase family protein | - |
| SH597_RS05620 (SH597_05620) | - | 1156237..1156827 (-) | 591 | WP_003605892.1 | DUF5067 domain-containing protein | - |
| SH597_RS05625 (SH597_05625) | - | 1156851..1157714 (-) | 864 | WP_161622023.1 | tetratricopeptide repeat protein | - |
| SH597_RS05630 (SH597_05630) | - | 1157738..1158184 (-) | 447 | WP_186338336.1 | ImmA/IrrE family metallo-endopeptidase | - |
| SH597_RS05635 (SH597_05635) | - | 1158203..1158661 (-) | 459 | WP_003582691.1 | helix-turn-helix domain-containing protein | - |
| SH597_RS05640 (SH597_05640) | - | 1158825..1159088 (+) | 264 | WP_016385974.1 | helix-turn-helix domain-containing protein | - |
| SH597_RS05645 (SH597_05645) | - | 1159250..1159648 (-) | 399 | WP_194854027.1 | hypothetical protein | - |
| SH597_RS05650 (SH597_05650) | - | 1159736..1159882 (+) | 147 | WP_194854028.1 | hypothetical protein | - |
| SH597_RS05655 (SH597_05655) | - | 1159948..1160496 (+) | 549 | WP_194854029.1 | hypothetical protein | - |
| SH597_RS05660 (SH597_05660) | - | 1160475..1160696 (+) | 222 | WP_003582309.1 | helix-turn-helix domain-containing protein | - |
| SH597_RS05665 (SH597_05665) | - | 1160709..1160837 (+) | 129 | WP_003581996.1 | hypothetical protein | - |
| SH597_RS05670 (SH597_05670) | - | 1160825..1161076 (+) | 252 | WP_194854030.1 | hypothetical protein | - |
| SH597_RS05675 (SH597_05675) | - | 1161069..1161476 (+) | 408 | WP_194854031.1 | hypothetical protein | - |
| SH597_RS05680 (SH597_05680) | - | 1161489..1162148 (+) | 660 | WP_194854032.1 | ERF family protein | - |
| SH597_RS05685 (SH597_05685) | ssb | 1162145..1162585 (+) | 441 | WP_194854033.1 | single-stranded DNA-binding protein | Machinery gene |
| SH597_RS05690 (SH597_05690) | - | 1162657..1163442 (+) | 786 | WP_228550492.1 | helix-turn-helix domain-containing protein | - |
| SH597_RS05695 (SH597_05695) | - | 1163429..1164211 (+) | 783 | WP_194854034.1 | ATP-binding protein | - |
| SH597_RS05700 (SH597_05700) | - | 1164208..1164537 (+) | 330 | WP_194854035.1 | hypothetical protein | - |
| SH597_RS05705 (SH597_05705) | - | 1164538..1164792 (+) | 255 | WP_194854036.1 | hypothetical protein | - |
| SH597_RS05710 (SH597_05710) | - | 1164789..1165154 (+) | 366 | WP_003607027.1 | endodeoxyribonuclease | - |
| SH597_RS05715 (SH597_05715) | - | 1165168..1165272 (+) | 105 | WP_194854037.1 | acetyltransferase | - |
| SH597_RS05720 (SH597_05720) | - | 1165275..1165823 (+) | 549 | WP_194854038.1 | DUF1642 domain-containing protein | - |
| SH597_RS05725 (SH597_05725) | - | 1165813..1166244 (+) | 432 | WP_194854039.1 | hypothetical protein | - |
| SH597_RS05730 (SH597_05730) | - | 1166241..1166615 (+) | 375 | WP_228550493.1 | DUF1642 domain-containing protein | - |
| SH597_RS05735 (SH597_05735) | - | 1166612..1166851 (+) | 240 | WP_194854040.1 | hypothetical protein | - |
| SH597_RS05740 (SH597_05740) | - | 1166848..1167096 (+) | 249 | WP_228550494.1 | hypothetical protein | - |
| SH597_RS05745 (SH597_05745) | - | 1167384..1167812 (+) | 429 | WP_003582019.1 | hypothetical protein | - |
| SH597_RS05750 (SH597_05750) | - | 1168503..1169033 (+) | 531 | WP_032760437.1 | DUF6932 family protein | - |
| SH597_RS05755 (SH597_05755) | - | 1169030..1169905 (+) | 876 | WP_194854041.1 | hypothetical protein | - |
| SH597_RS05760 (SH597_05760) | - | 1170296..1171513 (+) | 1218 | WP_194854042.1 | GcrA family cell cycle regulator | - |
| SH597_RS05765 (SH597_05765) | - | 1171500..1171829 (+) | 330 | WP_194854043.1 | ribonucleoside-diphosphate reductase | - |
| SH597_RS05770 (SH597_05770) | - | 1171866..1172429 (+) | 564 | WP_228550501.1 | terminase small subunit | - |
| SH597_RS05775 (SH597_05775) | - | 1172419..1173711 (+) | 1293 | WP_194854045.1 | PBSX family phage terminase large subunit | - |
| SH597_RS05780 (SH597_05780) | - | 1173713..1175233 (+) | 1521 | WP_194854046.1 | phage portal protein | - |
| SH597_RS05785 (SH597_05785) | - | 1175157..1175969 (+) | 813 | WP_228550495.1 | phage head morphogenesis protein | - |
| SH597_RS05790 (SH597_05790) | - | 1175981..1176307 (+) | 327 | WP_194854185.1 | hypothetical protein | - |
| SH597_RS05795 (SH597_05795) | - | 1176498..1177049 (+) | 552 | WP_194854047.1 | DUF4355 domain-containing protein | - |
| SH597_RS05800 (SH597_05800) | - | 1177063..1177980 (+) | 918 | WP_194854048.1 | phage capsid protein | - |
| SH597_RS05805 (SH597_05805) | - | 1178049..1178927 (+) | 879 | WP_194854049.1 | hypothetical protein | - |
| SH597_RS05810 (SH597_05810) | - | 1178927..1179286 (+) | 360 | WP_194854050.1 | phage head-tail connector protein | - |
| SH597_RS05815 (SH597_05815) | - | 1179283..1179579 (+) | 297 | WP_194854186.1 | hypothetical protein | - |
| SH597_RS05820 (SH597_05820) | - | 1179572..1179946 (+) | 375 | WP_194854051.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| SH597_RS05825 (SH597_05825) | - | 1179943..1180308 (+) | 366 | WP_194854052.1 | hypothetical protein | - |
| SH597_RS05830 (SH597_05830) | - | 1180310..1180921 (+) | 612 | WP_194854053.1 | phage major tail protein, TP901-1 family | - |
| SH597_RS05835 (SH597_05835) | - | 1180985..1181425 (+) | 441 | WP_194854054.1 | tail assembly chaperone | - |
| SH597_RS05840 (SH597_05840) | - | 1181497..1181730 (+) | 234 | WP_194854055.1 | hypothetical protein | - |
| SH597_RS05845 (SH597_05845) | - | 1181730..1184792 (+) | 3063 | WP_194854056.1 | phage tail tape measure protein | - |
| SH597_RS05850 (SH597_05850) | - | 1184796..1185614 (+) | 819 | WP_194854057.1 | phage tail domain-containing protein | - |
| SH597_RS05855 (SH597_05855) | - | 1185627..1187723 (+) | 2097 | WP_194854058.1 | phage tail protein | - |
| SH597_RS05860 (SH597_05860) | - | 1187692..1189872 (+) | 2181 | WP_194854059.1 | BppU family phage baseplate upper protein | - |
| SH597_RS05865 (SH597_05865) | - | 1189907..1190293 (+) | 387 | WP_194854060.1 | hypothetical protein | - |
| SH597_RS05870 (SH597_05870) | - | 1190274..1190483 (+) | 210 | WP_045601405.1 | hypothetical protein | - |
| SH597_RS05875 (SH597_05875) | - | 1190476..1190922 (+) | 447 | WP_147793235.1 | phage holin | - |
| SH597_RS05880 (SH597_05880) | - | 1190933..1192081 (+) | 1149 | WP_194854061.1 | GH25 family lysozyme | - |
| SH597_RS05885 (SH597_05885) | - | 1192278..1192352 (+) | 75 | Protein_1134 | glucose-6-phosphate isomerase | - |
| SH597_RS05890 (SH597_05890) | - | 1192710..1193493 (-) | 784 | Protein_1135 | DUF1828 domain-containing protein | - |
| SH597_RS05895 (SH597_05895) | - | 1193595..1193882 (-) | 288 | WP_003602001.1 | putative quinol monooxygenase | - |
| SH597_RS05900 (SH597_05900) | - | 1194065..1194595 (-) | 531 | WP_194854062.1 | hypothetical protein | - |
| SH597_RS05905 (SH597_05905) | - | 1194676..1195527 (-) | 852 | WP_194854063.1 | DNA/RNA non-specific endonuclease | - |
| SH597_RS05910 (SH597_05910) | - | 1195524..1196270 (-) | 747 | WP_194854064.1 | DNA-entry nuclease | - |
| SH597_RS05915 (SH597_05915) | - | 1196405..1197568 (-) | 1164 | WP_194854065.1 | glycosyltransferase | - |
| SH597_RS05920 (SH597_05920) | - | 1197955..1198872 (+) | 918 | WP_003574638.1 | Gfo/Idh/MocA family protein | - |
Sequence
Protein
Download Length: 146 a.a. Molecular weight: 16099.82 Da Isoelectric Point: 8.0184
>NTDB_id=908200 SH597_RS05685 WP_194854033.1 1162145..1162585(+) (ssb) [Lacticaseibacillus paracasei strain A02]
MINSVALNGRLTRDVDLRYTTSGIAVGQFTLAVDRRFKSKSGNRETDFIGCHIWRKSAENLANYAHKGSLIGIEGRIQTR
TYDNNQGQKVYVTEVIADNFSLLEPKPVQRTDNVGPSNNQTAQSTASQPSGNNGKPIDVNDDDLPF
MINSVALNGRLTRDVDLRYTTSGIAVGQFTLAVDRRFKSKSGNRETDFIGCHIWRKSAENLANYAHKGSLIGIEGRIQTR
TYDNNQGQKVYVTEVIADNFSLLEPKPVQRTDNVGPSNNQTAQSTASQPSGNNGKPIDVNDDDLPF
Nucleotide
Download Length: 441 bp
>NTDB_id=908200 SH597_RS05685 WP_194854033.1 1162145..1162585(+) (ssb) [Lacticaseibacillus paracasei strain A02]
GTGATCAATTCAGTTGCTCTTAATGGAAGATTAACAAGAGACGTCGATTTGCGTTACACCACGAGCGGAATTGCCGTTGG
ACAATTCACCTTGGCTGTTGACAGGCGTTTTAAAAGCAAAAGCGGTAATCGCGAGACAGACTTCATTGGTTGCCATATTT
GGAGAAAATCAGCAGAAAACCTAGCGAATTACGCTCACAAAGGTTCATTGATTGGTATTGAAGGACGTATTCAAACCCGC
ACTTATGACAATAACCAAGGACAAAAGGTTTATGTGACAGAAGTGATTGCCGATAACTTTAGCCTGCTAGAGCCAAAACC
AGTACAGCGGACAGATAATGTAGGGCCGTCAAACAATCAGACCGCGCAGAGTACAGCAAGTCAGCCTAGCGGGAACAACG
GCAAACCGATTGATGTTAATGATGACGATCTTCCATTTTAA
GTGATCAATTCAGTTGCTCTTAATGGAAGATTAACAAGAGACGTCGATTTGCGTTACACCACGAGCGGAATTGCCGTTGG
ACAATTCACCTTGGCTGTTGACAGGCGTTTTAAAAGCAAAAGCGGTAATCGCGAGACAGACTTCATTGGTTGCCATATTT
GGAGAAAATCAGCAGAAAACCTAGCGAATTACGCTCACAAAGGTTCATTGATTGGTATTGAAGGACGTATTCAAACCCGC
ACTTATGACAATAACCAAGGACAAAAGGTTTATGTGACAGAAGTGATTGCCGATAACTTTAGCCTGCTAGAGCCAAAACC
AGTACAGCGGACAGATAATGTAGGGCCGTCAAACAATCAGACCGCGCAGAGTACAGCAAGTCAGCCTAGCGGGAACAACG
GCAAACCGATTGATGTTAATGATGACGATCTTCCATTTTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Latilactobacillus sakei subsp. sakei 23K |
54.118 |
100 |
0.63 |
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
48.256 |
100 |
0.568 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
56.364 |
75.342 |
0.425 |
| ssb | Vibrio cholerae strain A1552 |
30.857 |
100 |
0.37 |