Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   SIS06_RS13500 Genome accession   NZ_CP139188
Coordinates   2556404..2556577 (+) Length   57 a.a.
NCBI ID   WP_014477323.1    Uniprot ID   -
Organism   Bacillus subtilis strain H17-16     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2551404..2561577
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  SIS06_RS13485 (SIS06_13485) gcvT 2552202..2553290 (-) 1089 WP_283933554.1 glycine cleavage system aminomethyltransferase GcvT -
  SIS06_RS13490 (SIS06_13490) hepAA 2553732..2555405 (+) 1674 WP_169037820.1 DEAD/DEAH box helicase -
  SIS06_RS13495 (SIS06_13495) yqhG 2555426..2556220 (+) 795 WP_032726154.1 YqhG family protein -
  SIS06_RS13500 (SIS06_13500) sinI 2556404..2556577 (+) 174 WP_014477323.1 anti-repressor SinI Regulator
  SIS06_RS13505 (SIS06_13505) sinR 2556611..2556946 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  SIS06_RS13510 (SIS06_13510) tasA 2557038..2557823 (-) 786 WP_014477324.1 biofilm matrix protein TasA -
  SIS06_RS13515 (SIS06_13515) sipW 2557888..2558460 (-) 573 WP_003230181.1 signal peptidase I SipW -
  SIS06_RS13520 (SIS06_13520) tapA 2558444..2559205 (-) 762 WP_283933555.1 amyloid fiber anchoring/assembly protein TapA -
  SIS06_RS13525 (SIS06_13525) yqzG 2559477..2559803 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  SIS06_RS13530 (SIS06_13530) spoIITA 2559845..2560024 (-) 180 WP_014480252.1 YqzE family protein -
  SIS06_RS13535 (SIS06_13535) comGG 2560095..2560469 (-) 375 WP_283933556.1 ComG operon protein ComGG Machinery gene
  SIS06_RS13540 (SIS06_13540) comGF 2560470..2560853 (-) 384 WP_283933557.1 ComG operon protein ComGF Machinery gene
  SIS06_RS13545 (SIS06_13545) comGE 2560879..2561226 (-) 348 WP_283933558.1 ComG operon protein 5 Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6633.58 Da        Isoelectric Point: 6.7231

>NTDB_id=907632 SIS06_RS13500 WP_014477323.1 2556404..2556577(+) (sinI) [Bacillus subtilis strain H17-16]
MKNAKQEHFELDQEWVELMMEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=907632 SIS06_RS13500 WP_014477323.1 2556404..2556577(+) (sinI) [Bacillus subtilis strain H17-16]
ATGAAAAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTGATGATGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-36)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

98.246

100

0.982