Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGD   Type   Machinery gene
Locus tag   SH592_RS11815 Genome accession   NZ_CP139053
Coordinates   2471284..2471721 (-) Length   145 a.a.
NCBI ID   WP_015417817.1    Uniprot ID   -
Organism   Bacillus velezensis strain Y-4     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2466284..2476721
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  SH592_RS11765 (SH592_11765) sinI 2466668..2466841 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  SH592_RS11770 (SH592_11770) sinR 2466875..2467210 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  SH592_RS11775 (SH592_11775) tasA 2467258..2468043 (-) 786 WP_007408329.1 biofilm matrix protein TasA -
  SH592_RS11780 (SH592_11780) sipW 2468108..2468692 (-) 585 WP_015240205.1 signal peptidase I SipW -
  SH592_RS11785 (SH592_11785) tapA 2468664..2469335 (-) 672 WP_015417813.1 amyloid fiber anchoring/assembly protein TapA -
  SH592_RS11790 (SH592_11790) - 2469594..2469923 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  SH592_RS11795 (SH592_11795) - 2469963..2470142 (-) 180 WP_003153093.1 YqzE family protein -
  SH592_RS11800 (SH592_11800) comGG 2470199..2470576 (-) 378 WP_015417814.1 competence type IV pilus minor pilin ComGG Machinery gene
  SH592_RS11805 (SH592_11805) comGF 2470577..2471077 (-) 501 WP_258548905.1 competence type IV pilus minor pilin ComGF -
  SH592_RS11810 (SH592_11810) comGE 2470986..2471300 (-) 315 WP_031378943.1 competence type IV pilus minor pilin ComGE -
  SH592_RS11815 (SH592_11815) comGD 2471284..2471721 (-) 438 WP_015417817.1 competence type IV pilus minor pilin ComGD Machinery gene
  SH592_RS11820 (SH592_11820) comGC 2471711..2472019 (-) 309 WP_015417818.1 competence type IV pilus major pilin ComGC Machinery gene
  SH592_RS11825 (SH592_11825) comGB 2472024..2473061 (-) 1038 WP_015417819.1 competence type IV pilus assembly protein ComGB Machinery gene
  SH592_RS11830 (SH592_11830) comGA 2473048..2474117 (-) 1070 Protein_2282 competence type IV pilus ATPase ComGA -
  SH592_RS11835 (SH592_11835) - 2474310..2475260 (-) 951 WP_015417820.1 magnesium transporter CorA family protein -
  SH592_RS11840 (SH592_11840) - 2475406..2476707 (+) 1302 WP_012117986.1 hemolysin family protein -

Sequence


Protein


Download         Length: 145 a.a.        Molecular weight: 16226.70 Da        Isoelectric Point: 10.1850

>NTDB_id=907034 SH592_RS11815 WP_015417817.1 2471284..2471721(-) (comGD) [Bacillus velezensis strain Y-4]
MNNNRRTENGFTLLESLIVLSLASVLLTVLFTTVPPACTHLAVRQKTEQLQKDIQLAQETAIAEHKRTKITFLPKEHKYK
LQSGGRIVERSFDSLHITLVTLPESLEFNEKGHPNSGGKIQLKSAGFTYEITVYLGSGNVHAKRK

Nucleotide


Download         Length: 438 bp        

>NTDB_id=907034 SH592_RS11815 WP_015417817.1 2471284..2471721(-) (comGD) [Bacillus velezensis strain Y-4]
TTGAACAATAACAGGCGGACAGAAAATGGGTTTACCCTTCTTGAAAGCCTGATTGTGTTAAGTCTGGCGTCCGTCCTGCT
GACGGTTTTGTTCACGACGGTTCCGCCGGCCTGCACCCACCTTGCCGTGCGGCAAAAAACAGAACAGCTCCAAAAAGATA
TTCAGCTTGCTCAGGAAACGGCTATCGCAGAACATAAAAGAACAAAAATCACTTTTCTTCCAAAAGAGCATAAATACAAA
CTGCAGTCAGGCGGAAGGATTGTCGAGCGTTCCTTTGATTCGCTTCACATTACACTTGTGACTTTACCGGAGAGCCTTGA
ATTTAACGAAAAAGGCCATCCGAATTCGGGAGGAAAGATCCAATTGAAGAGCGCCGGGTTCACCTATGAGATCACAGTTT
ACTTAGGGAGCGGAAATGTCCATGCTAAACGGAAATAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGD Bacillus subtilis subsp. subtilis str. 168

56.164

100

0.566