Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   SH592_RS11765 Genome accession   NZ_CP139053
Coordinates   2466668..2466841 (+) Length   57 a.a.
NCBI ID   WP_003153105.1    Uniprot ID   A7Z6M7
Organism   Bacillus velezensis strain Y-4     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2461668..2471841
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  SH592_RS11750 (SH592_11750) gcvT 2462481..2463581 (-) 1101 WP_031378949.1 glycine cleavage system aminomethyltransferase GcvT -
  SH592_RS11755 (SH592_11755) - 2464005..2465675 (+) 1671 WP_015417810.1 DEAD/DEAH box helicase -
  SH592_RS11760 (SH592_11760) - 2465697..2466491 (+) 795 WP_007408330.1 YqhG family protein -
  SH592_RS11765 (SH592_11765) sinI 2466668..2466841 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  SH592_RS11770 (SH592_11770) sinR 2466875..2467210 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  SH592_RS11775 (SH592_11775) tasA 2467258..2468043 (-) 786 WP_007408329.1 biofilm matrix protein TasA -
  SH592_RS11780 (SH592_11780) sipW 2468108..2468692 (-) 585 WP_015240205.1 signal peptidase I SipW -
  SH592_RS11785 (SH592_11785) tapA 2468664..2469335 (-) 672 WP_015417813.1 amyloid fiber anchoring/assembly protein TapA -
  SH592_RS11790 (SH592_11790) - 2469594..2469923 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  SH592_RS11795 (SH592_11795) - 2469963..2470142 (-) 180 WP_003153093.1 YqzE family protein -
  SH592_RS11800 (SH592_11800) comGG 2470199..2470576 (-) 378 WP_015417814.1 competence type IV pilus minor pilin ComGG Machinery gene
  SH592_RS11805 (SH592_11805) comGF 2470577..2471077 (-) 501 WP_258548905.1 competence type IV pilus minor pilin ComGF -
  SH592_RS11810 (SH592_11810) comGE 2470986..2471300 (-) 315 WP_031378943.1 competence type IV pilus minor pilin ComGE -
  SH592_RS11815 (SH592_11815) comGD 2471284..2471721 (-) 438 WP_015417817.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6695.72 Da        Isoelectric Point: 9.8170

>NTDB_id=907031 SH592_RS11765 WP_003153105.1 2466668..2466841(+) (sinI) [Bacillus velezensis strain Y-4]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=907031 SH592_RS11765 WP_003153105.1 2466668..2466841(+) (sinI) [Bacillus velezensis strain Y-4]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterproScan.

(11-37)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A7Z6M7

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

70.175

100

0.702