Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | SH592_RS11765 | Genome accession | NZ_CP139053 |
| Coordinates | 2466668..2466841 (+) | Length | 57 a.a. |
| NCBI ID | WP_003153105.1 | Uniprot ID | A7Z6M7 |
| Organism | Bacillus velezensis strain Y-4 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2461668..2471841
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SH592_RS11750 (SH592_11750) | gcvT | 2462481..2463581 (-) | 1101 | WP_031378949.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| SH592_RS11755 (SH592_11755) | - | 2464005..2465675 (+) | 1671 | WP_015417810.1 | DEAD/DEAH box helicase | - |
| SH592_RS11760 (SH592_11760) | - | 2465697..2466491 (+) | 795 | WP_007408330.1 | YqhG family protein | - |
| SH592_RS11765 (SH592_11765) | sinI | 2466668..2466841 (+) | 174 | WP_003153105.1 | anti-repressor SinI | Regulator |
| SH592_RS11770 (SH592_11770) | sinR | 2466875..2467210 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| SH592_RS11775 (SH592_11775) | tasA | 2467258..2468043 (-) | 786 | WP_007408329.1 | biofilm matrix protein TasA | - |
| SH592_RS11780 (SH592_11780) | sipW | 2468108..2468692 (-) | 585 | WP_015240205.1 | signal peptidase I SipW | - |
| SH592_RS11785 (SH592_11785) | tapA | 2468664..2469335 (-) | 672 | WP_015417813.1 | amyloid fiber anchoring/assembly protein TapA | - |
| SH592_RS11790 (SH592_11790) | - | 2469594..2469923 (+) | 330 | WP_012117979.1 | DUF3889 domain-containing protein | - |
| SH592_RS11795 (SH592_11795) | - | 2469963..2470142 (-) | 180 | WP_003153093.1 | YqzE family protein | - |
| SH592_RS11800 (SH592_11800) | comGG | 2470199..2470576 (-) | 378 | WP_015417814.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| SH592_RS11805 (SH592_11805) | comGF | 2470577..2471077 (-) | 501 | WP_258548905.1 | competence type IV pilus minor pilin ComGF | - |
| SH592_RS11810 (SH592_11810) | comGE | 2470986..2471300 (-) | 315 | WP_031378943.1 | competence type IV pilus minor pilin ComGE | - |
| SH592_RS11815 (SH592_11815) | comGD | 2471284..2471721 (-) | 438 | WP_015417817.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6695.72 Da Isoelectric Point: 9.8170
>NTDB_id=907031 SH592_RS11765 WP_003153105.1 2466668..2466841(+) (sinI) [Bacillus velezensis strain Y-4]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=907031 SH592_RS11765 WP_003153105.1 2466668..2466841(+) (sinI) [Bacillus velezensis strain Y-4]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
70.175 |
100 |
0.702 |