Detailed information
Overview
| Name | comGF | Type | Machinery gene |
| Locus tag | SC043_RS10955 | Genome accession | NZ_CP138309 |
| Coordinates | 2157325..2157771 (-) | Length | 148 a.a. |
| NCBI ID | WP_031296844.1 | Uniprot ID | A0AAC9R3D6 |
| Organism | Lactococcus lactis strain B26 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2154731..2194279 | 2157325..2157771 | within | 0 |
Gene organization within MGE regions
Location: 2154731..2194279
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SC043_RS10935 (SC043_10935) | - | 2154731..2155468 (-) | 738 | WP_010906311.1 | metal ABC transporter ATP-binding protein | - |
| SC043_RS10940 (SC043_10940) | - | 2155645..2156487 (-) | 843 | WP_010906312.1 | metal ABC transporter substrate-binding protein | - |
| SC043_RS10945 (SC043_10945) | - | 2156484..2156921 (-) | 438 | WP_010906313.1 | zinc-dependent MarR family transcriptional regulator | - |
| SC043_RS10950 (SC043_10950) | comGG | 2157002..2157286 (-) | 285 | WP_010906314.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| SC043_RS10955 (SC043_10955) | comGF | 2157325..2157771 (-) | 447 | WP_031296844.1 | competence type IV pilus minor pilin ComGF | Machinery gene |
| SC043_RS10960 (SC043_10960) | comGE | 2157734..2158030 (-) | 297 | WP_010906316.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| SC043_RS10965 (SC043_10965) | comGD | 2158002..2158418 (-) | 417 | WP_021216554.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
| SC043_RS10970 (SC043_10970) | comGC | 2158393..2158677 (-) | 285 | WP_032941550.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| SC043_RS10975 (SC043_10975) | - | 2158809..2159333 (-) | 525 | WP_014570795.1 | GNAT family N-acetyltransferase | - |
| SC043_RS10980 (SC043_10980) | - | 2159412..2160191 (-) | 780 | WP_058147788.1 | peptidoglycan amidohydrolase family protein | - |
| SC043_RS10985 (SC043_10985) | - | 2160191..2160490 (-) | 300 | WP_031559226.1 | phage holin | - |
| SC043_RS10990 (SC043_10990) | - | 2160503..2160853 (-) | 351 | WP_023349296.1 | hypothetical protein | - |
| SC043_RS13085 | - | 2160873..2161718 (-) | 846 | Protein_2141 | hypothetical protein | - |
| SC043_RS11000 (SC043_11000) | - | 2162431..2162604 (-) | 174 | WP_032941620.1 | hypothetical protein | - |
| SC043_RS11005 (SC043_11005) | - | 2162604..2163725 (-) | 1122 | WP_031297171.1 | hypothetical protein | - |
| SC043_RS11010 (SC043_11010) | - | 2163742..2165535 (-) | 1794 | WP_031297170.1 | phage tail protein | - |
| SC043_RS11015 (SC043_11015) | - | 2165532..2167052 (-) | 1521 | WP_058147722.1 | distal tail protein Dit | - |
| SC043_RS11020 (SC043_11020) | - | 2167062..2169671 (-) | 2610 | WP_023349195.1 | hypothetical protein | - |
| SC043_RS11025 (SC043_11025) | - | 2169661..2170368 (-) | 708 | WP_014570560.1 | Gp15 family bacteriophage protein | - |
| SC043_RS11030 (SC043_11030) | - | 2170384..2170791 (-) | 408 | WP_003131323.1 | hypothetical protein | - |
| SC043_RS11035 (SC043_11035) | - | 2170848..2171324 (-) | 477 | WP_014570559.1 | phage tail tube protein | - |
| SC043_RS11040 (SC043_11040) | - | 2171335..2171769 (-) | 435 | WP_003131321.1 | minor capsid protein | - |
| SC043_RS11045 (SC043_11045) | - | 2171769..2172098 (-) | 330 | WP_003131320.1 | hypothetical protein | - |
| SC043_RS11050 (SC043_11050) | - | 2172095..2172439 (-) | 345 | WP_003131319.1 | putative minor capsid protein | - |
| SC043_RS11055 (SC043_11055) | - | 2172429..2172830 (-) | 402 | WP_014570556.1 | hypothetical protein | - |
| SC043_RS11060 (SC043_11060) | - | 2172904..2173140 (-) | 237 | WP_023349196.1 | Ig-like domain-containing protein | - |
| SC043_RS11065 (SC043_11065) | - | 2173169..2174086 (-) | 918 | WP_023349197.1 | phage capsid protein | - |
| SC043_RS11070 (SC043_11070) | - | 2174101..2175153 (-) | 1053 | WP_023349198.1 | XkdF-like putative serine protease domain-containing protein | - |
| SC043_RS11075 (SC043_11075) | - | 2175169..2175999 (-) | 831 | WP_023349199.1 | phage minor head protein | - |
| SC043_RS11080 (SC043_11080) | - | 2175992..2177521 (-) | 1530 | WP_023349200.1 | phage portal protein | - |
| SC043_RS11085 (SC043_11085) | terL | 2177534..2178985 (-) | 1452 | WP_023349201.1 | phage terminase large subunit | - |
| SC043_RS11090 (SC043_11090) | - | 2178966..2179463 (-) | 498 | WP_023349202.1 | hypothetical protein | - |
| SC043_RS11095 (SC043_11095) | - | 2179492..2180649 (-) | 1158 | WP_023349203.1 | DNA modification methylase | - |
| SC043_RS11105 (SC043_11105) | - | 2181126..2181548 (-) | 423 | WP_023349204.1 | RinA family protein | - |
| SC043_RS11110 (SC043_11110) | - | 2181625..2181933 (-) | 309 | WP_023349205.1 | hypothetical protein | - |
| SC043_RS11115 (SC043_11115) | - | 2182062..2182256 (-) | 195 | WP_023349206.1 | DUF1660 domain-containing protein | - |
| SC043_RS11120 (SC043_11120) | - | 2182253..2182471 (-) | 219 | WP_014570803.1 | hypothetical protein | - |
| SC043_RS11125 (SC043_11125) | - | 2182518..2182763 (-) | 246 | WP_023349207.1 | hypothetical protein | - |
| SC043_RS11130 (SC043_11130) | - | 2182785..2183144 (-) | 360 | WP_023349208.1 | hypothetical protein | - |
| SC043_RS11135 (SC043_11135) | dut | 2183147..2183566 (-) | 420 | WP_023349209.1 | dUTP diphosphatase | - |
| SC043_RS11140 (SC043_11140) | - | 2183563..2183868 (-) | 306 | WP_023349170.1 | hypothetical protein | - |
| SC043_RS11145 (SC043_11145) | - | 2183865..2184368 (-) | 504 | WP_023349171.1 | DUF1642 domain-containing protein | - |
| SC043_RS11150 (SC043_11150) | - | 2184361..2184567 (-) | 207 | WP_010905356.1 | DUF1125 domain-containing protein | - |
| SC043_RS11155 (SC043_11155) | - | 2185073..2185483 (-) | 411 | WP_014570810.1 | hypothetical protein | - |
| SC043_RS11160 (SC043_11160) | - | 2185496..2185738 (-) | 243 | WP_023349173.1 | L-rhamnose isomerase | - |
| SC043_RS11165 (SC043_11165) | - | 2185731..2186654 (-) | 924 | WP_023349174.1 | phage replisome organizer N-terminal domain-containing protein | - |
| SC043_RS11170 (SC043_11170) | - | 2186918..2187844 (-) | 927 | WP_014570813.1 | RecT family recombinase | - |
| SC043_RS11175 (SC043_11175) | - | 2187841..2188674 (-) | 834 | WP_023349175.1 | hypothetical protein | - |
| SC043_RS11180 (SC043_11180) | - | 2188777..2189025 (-) | 249 | WP_014570815.1 | hypothetical protein | - |
| SC043_RS11185 (SC043_11185) | - | 2189039..2189161 (-) | 123 | WP_023164646.1 | hypothetical protein | - |
| SC043_RS11190 (SC043_11190) | - | 2189158..2189340 (-) | 183 | WP_023349176.1 | hypothetical protein | - |
| SC043_RS11195 (SC043_11195) | - | 2189404..2189613 (-) | 210 | WP_023349177.1 | helix-turn-helix transcriptional regulator | - |
| SC043_RS11200 (SC043_11200) | - | 2189804..2190226 (+) | 423 | WP_023349178.1 | helix-turn-helix transcriptional regulator | - |
| SC043_RS11205 (SC043_11205) | - | 2190237..2190821 (+) | 585 | WP_023349179.1 | hypothetical protein | - |
| SC043_RS11210 (SC043_11210) | - | 2190875..2191537 (+) | 663 | WP_023349180.1 | SHOCT domain-containing protein | - |
| SC043_RS11215 (SC043_11215) | - | 2191652..2193109 (+) | 1458 | WP_023349181.1 | recombinase family protein | - |
| SC043_RS11220 (SC043_11220) | - | 2193106..2193246 (-) | 141 | WP_023349182.1 | hypothetical protein | - |
Sequence
Protein
Download Length: 148 a.a. Molecular weight: 17083.85 Da Isoelectric Point: 8.6780
>NTDB_id=901724 SC043_RS10955 WP_031296844.1 2157325..2157771(-) (comGF) [Lactococcus lactis strain B26]
MERKLCDLNFKVKAFTLLECLVALLAISGSALVISGLTKMLKEQVAISQSDSIKDWQIFCQQMRFELSGTKLDRVEQNFL
YVTKDKKLRFGFMSDDFRKTDDKGQGYQPMLYDIKAAKIQATKNLITIRIDFNQGGERTFIYQFPEDT
MERKLCDLNFKVKAFTLLECLVALLAISGSALVISGLTKMLKEQVAISQSDSIKDWQIFCQQMRFELSGTKLDRVEQNFL
YVTKDKKLRFGFMSDDFRKTDDKGQGYQPMLYDIKAAKIQATKNLITIRIDFNQGGERTFIYQFPEDT
Nucleotide
Download Length: 447 bp
>NTDB_id=901724 SC043_RS10955 WP_031296844.1 2157325..2157771(-) (comGF) [Lactococcus lactis strain B26]
ATGGAAAGGAAATTATGCGACTTGAACTTCAAAGTTAAAGCATTTACCTTGTTGGAGTGTTTGGTGGCACTTCTTGCAAT
TTCTGGTTCAGCCCTTGTCATCTCAGGTTTAACAAAGATGTTGAAAGAACAAGTGGCGATTAGTCAAAGTGATAGCATAA
AAGATTGGCAAATTTTCTGTCAGCAAATGCGTTTTGAACTCTCAGGAACAAAATTAGATAGGGTAGAACAGAATTTTCTG
TATGTAACTAAAGATAAAAAACTAAGGTTTGGTTTTATGAGTGATGATTTCCGGAAGACTGATGACAAAGGTCAGGGTTA
TCAGCCAATGCTTTATGATATAAAAGCGGCTAAGATTCAAGCTACTAAAAATTTAATAACCATAAGAATTGATTTTAATC
AAGGAGGTGAAAGAACATTTATTTATCAATTTCCAGAAGATACGTAA
ATGGAAAGGAAATTATGCGACTTGAACTTCAAAGTTAAAGCATTTACCTTGTTGGAGTGTTTGGTGGCACTTCTTGCAAT
TTCTGGTTCAGCCCTTGTCATCTCAGGTTTAACAAAGATGTTGAAAGAACAAGTGGCGATTAGTCAAAGTGATAGCATAA
AAGATTGGCAAATTTTCTGTCAGCAAATGCGTTTTGAACTCTCAGGAACAAAATTAGATAGGGTAGAACAGAATTTTCTG
TATGTAACTAAAGATAAAAAACTAAGGTTTGGTTTTATGAGTGATGATTTCCGGAAGACTGATGACAAAGGTCAGGGTTA
TCAGCCAATGCTTTATGATATAAAAGCGGCTAAGATTCAAGCTACTAAAAATTTAATAACCATAAGAATTGATTTTAATC
AAGGAGGTGAAAGAACATTTATTTATCAATTTCCAGAAGATACGTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGF | Lactococcus lactis subsp. cremoris KW2 |
75.54 |
93.919 |
0.709 |
| comYF | Streptococcus mutans UA140 |
47.518 |
95.27 |
0.453 |
| comYF | Streptococcus mutans UA159 |
46.809 |
95.27 |
0.446 |
| comGF/cglF | Streptococcus mitis SK321 |
43.066 |
92.568 |
0.399 |
| comGF/cglF | Streptococcus pneumoniae Rx1 |
40.426 |
95.27 |
0.385 |
| comGF/cglF | Streptococcus pneumoniae D39 |
40.426 |
95.27 |
0.385 |
| comGF/cglF | Streptococcus pneumoniae R6 |
40.426 |
95.27 |
0.385 |
| comGF/cglF | Streptococcus pneumoniae TIGR4 |
40.426 |
95.27 |
0.385 |
| comGF/cglF | Streptococcus mitis NCTC 12261 |
41.606 |
92.568 |
0.385 |