Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | SB028_RS17580 | Genome accession | NZ_CP137920 |
| Coordinates | 3736693..3737145 (+) | Length | 150 a.a. |
| NCBI ID | WP_318859703.1 | Uniprot ID | - |
| Organism | Proteus vulgaris strain 2023JQ-00005 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 3699392..3744655 | 3736693..3737145 | within | 0 |
Gene organization within MGE regions
Location: 3699392..3744655
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SB028_RS17340 (SB028_17340) | potA | 3699392..3700507 (-) | 1116 | WP_069366991.1 | spermidine/putrescine ABC transporter ATP-binding protein PotA | - |
| SB028_RS17345 (SB028_17345) | - | 3701053..3702339 (-) | 1287 | WP_069366992.1 | S8 family peptidase | - |
| SB028_RS17350 (SB028_17350) | cbrC | 3702500..3703090 (-) | 591 | WP_069366993.1 | PF03691 family colicin E2 tolerance protein CbrC | - |
| SB028_RS17355 (SB028_17355) | - | 3703430..3704959 (-) | 1530 | WP_318859676.1 | hypothetical protein | - |
| SB028_RS17360 (SB028_17360) | - | 3704975..3708313 (-) | 3339 | WP_318859677.1 | DUF1983 domain-containing protein | - |
| SB028_RS17365 (SB028_17365) | - | 3708314..3708712 (-) | 399 | WP_260664443.1 | DUF6950 family protein | - |
| SB028_RS17370 (SB028_17370) | - | 3708770..3709420 (-) | 651 | WP_072063031.1 | hypothetical protein | - |
| SB028_RS17375 (SB028_17375) | - | 3709439..3710020 (-) | 582 | WP_161769687.1 | hypothetical protein | - |
| SB028_RS17380 (SB028_17380) | - | 3710017..3710616 (-) | 600 | WP_318859678.1 | hypothetical protein | - |
| SB028_RS17385 (SB028_17385) | - | 3710617..3713898 (-) | 3282 | WP_260664446.1 | phage tail tape measure protein | - |
| SB028_RS17390 (SB028_17390) | - | 3714149..3714499 (-) | 351 | WP_260664447.1 | phage tail protein | - |
| SB028_RS17395 (SB028_17395) | - | 3714499..3714975 (-) | 477 | WP_260664448.1 | phage tail protein | - |
| SB028_RS17400 (SB028_17400) | - | 3714987..3715388 (-) | 402 | WP_318860148.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| SB028_RS17405 (SB028_17405) | - | 3715388..3715777 (-) | 390 | WP_318859679.1 | hypothetical protein | - |
| SB028_RS17410 (SB028_17410) | - | 3715764..3716090 (-) | 327 | WP_318859680.1 | phage head closure protein | - |
| SB028_RS17415 (SB028_17415) | - | 3716097..3716399 (-) | 303 | WP_270756004.1 | head-tail connector protein | - |
| SB028_RS17420 (SB028_17420) | - | 3716486..3717715 (-) | 1230 | WP_318860149.1 | phage major capsid protein | - |
| SB028_RS17425 (SB028_17425) | - | 3717731..3718336 (-) | 606 | WP_006533922.1 | HK97 family phage prohead protease | - |
| SB028_RS17430 (SB028_17430) | - | 3718326..3719555 (-) | 1230 | WP_318859681.1 | phage portal protein | - |
| SB028_RS17435 (SB028_17435) | - | 3719545..3719706 (-) | 162 | WP_006533924.1 | hypothetical protein | - |
| SB028_RS17440 (SB028_17440) | - | 3719703..3721433 (-) | 1731 | WP_252957043.1 | terminase large subunit | - |
| SB028_RS17445 (SB028_17445) | - | 3721430..3721924 (-) | 495 | WP_161706117.1 | phage terminase small subunit P27 family | - |
| SB028_RS17450 (SB028_17450) | - | 3722157..3722504 (-) | 348 | WP_318859682.1 | HNH endonuclease | - |
| SB028_RS17455 (SB028_17455) | - | 3722591..3723010 (-) | 420 | WP_318859683.1 | hypothetical protein | - |
| SB028_RS17460 (SB028_17460) | - | 3723538..3723699 (-) | 162 | WP_318859684.1 | hypothetical protein | - |
| SB028_RS17465 (SB028_17465) | - | 3723696..3724157 (-) | 462 | WP_318859685.1 | lysis protein | - |
| SB028_RS17470 (SB028_17470) | - | 3724160..3724318 (-) | 159 | WP_318859686.1 | hypothetical protein | - |
| SB028_RS17475 (SB028_17475) | - | 3724300..3724770 (-) | 471 | WP_318859687.1 | lysozyme | - |
| SB028_RS17480 (SB028_17480) | - | 3724770..3725039 (-) | 270 | WP_036904926.1 | bacteriophage protein | - |
| SB028_RS17485 (SB028_17485) | - | 3725210..3725389 (+) | 180 | WP_290013701.1 | hypothetical protein | - |
| SB028_RS17490 (SB028_17490) | - | 3725379..3725552 (-) | 174 | WP_318859688.1 | hypothetical protein | - |
| SB028_RS17495 (SB028_17495) | - | 3725803..3726717 (+) | 915 | WP_318859689.1 | hypothetical protein | - |
| SB028_RS17500 (SB028_17500) | - | 3726827..3727378 (-) | 552 | WP_318859690.1 | DUF1133 family protein | - |
| SB028_RS17505 (SB028_17505) | - | 3727405..3728430 (-) | 1026 | WP_318859691.1 | DUF968 domain-containing protein | - |
| SB028_RS17510 (SB028_17510) | - | 3728427..3729230 (-) | 804 | WP_318859692.1 | KilA-N domain-containing protein | - |
| SB028_RS17515 (SB028_17515) | - | 3729249..3729635 (-) | 387 | WP_318859693.1 | RusA family crossover junction endodeoxyribonuclease | - |
| SB028_RS20780 | - | 3729698..3729868 (-) | 171 | WP_198794126.1 | Lar family restriction alleviation protein | - |
| SB028_RS17520 (SB028_17520) | - | 3729865..3730260 (-) | 396 | WP_318859694.1 | hypothetical protein | - |
| SB028_RS17525 (SB028_17525) | - | 3730257..3730895 (-) | 639 | WP_318859695.1 | phage N-6-adenine-methyltransferase | - |
| SB028_RS17530 (SB028_17530) | - | 3730892..3731956 (-) | 1065 | WP_318859696.1 | conserved phage C-terminal domain-containing protein | - |
| SB028_RS17540 (SB028_17540) | - | 3732138..3732317 (-) | 180 | WP_318859697.1 | hypothetical protein | - |
| SB028_RS17545 (SB028_17545) | - | 3732406..3732864 (-) | 459 | WP_318859698.1 | YmfL family putative regulatory protein | - |
| SB028_RS17550 (SB028_17550) | - | 3732880..3733542 (-) | 663 | WP_318859699.1 | hypothetical protein | - |
| SB028_RS17555 (SB028_17555) | - | 3733593..3733772 (-) | 180 | WP_318859700.1 | Cro/CI family transcriptional regulator | - |
| SB028_RS17560 (SB028_17560) | - | 3733878..3734516 (+) | 639 | WP_375804079.1 | LexA family protein | - |
| SB028_RS17565 (SB028_17565) | - | 3734643..3734846 (+) | 204 | WP_318859701.1 | hypothetical protein | - |
| SB028_RS17570 (SB028_17570) | - | 3735213..3736085 (+) | 873 | WP_318860150.1 | recombination-associated protein RdgC | - |
| SB028_RS17575 (SB028_17575) | - | 3736167..3736700 (+) | 534 | WP_318859702.1 | HD family hydrolase | - |
| SB028_RS17580 (SB028_17580) | ssb | 3736693..3737145 (+) | 453 | WP_318859703.1 | single-stranded DNA-binding protein | Machinery gene |
| SB028_RS17585 (SB028_17585) | - | 3737403..3737684 (+) | 282 | WP_318859704.1 | hypothetical protein | - |
| SB028_RS17590 (SB028_17590) | - | 3737687..3738262 (+) | 576 | WP_318859705.1 | hypothetical protein | - |
| SB028_RS17595 (SB028_17595) | - | 3738265..3738471 (+) | 207 | WP_318859706.1 | hypothetical protein | - |
| SB028_RS17600 (SB028_17600) | - | 3738719..3738964 (+) | 246 | WP_072065179.1 | pyocin activator PrtN family protein | - |
| SB028_RS17605 (SB028_17605) | - | 3739008..3739295 (-) | 288 | WP_318859707.1 | DinI-like family protein | - |
| SB028_RS17610 (SB028_17610) | - | 3739349..3740431 (-) | 1083 | WP_318859708.1 | site-specific integrase | - |
| SB028_RS17615 (SB028_17615) | dusA | 3740528..3741562 (+) | 1035 | WP_069368321.1 | tRNA dihydrouridine(20/20a) synthase DusA | - |
| SB028_RS17620 (SB028_17620) | - | 3741601..3741915 (-) | 315 | WP_069368322.1 | hypothetical protein | - |
| SB028_RS17625 (SB028_17625) | - | 3742107..3743090 (-) | 984 | WP_069368323.1 | quinone oxidoreductase | - |
| SB028_RS17630 (SB028_17630) | dnaB | 3743246..3744655 (+) | 1410 | WP_023583065.1 | replicative DNA helicase | - |
Sequence
Protein
Download Length: 150 a.a. Molecular weight: 16546.63 Da Isoelectric Point: 6.9805
>NTDB_id=901279 SB028_RS17580 WP_318859703.1 3736693..3737145(+) (ssb) [Proteus vulgaris strain 2023JQ-00005]
MANGSVNKVIIIGNLGRDPEIRYLPSGGAIAYLAVATSEKWRDKQTGENREKTEWHRVVLFGKLADIASGYLCKGSQVYI
EGQLQTREWDDNGVKRYTTEVVVRIGGTMQMLGGASKSAGSQPAQQPQQSKQQAPQYPEPPMDFSDDIPF
MANGSVNKVIIIGNLGRDPEIRYLPSGGAIAYLAVATSEKWRDKQTGENREKTEWHRVVLFGKLADIASGYLCKGSQVYI
EGQLQTREWDDNGVKRYTTEVVVRIGGTMQMLGGASKSAGSQPAQQPQQSKQQAPQYPEPPMDFSDDIPF
Nucleotide
Download Length: 453 bp
>NTDB_id=901279 SB028_RS17580 WP_318859703.1 3736693..3737145(+) (ssb) [Proteus vulgaris strain 2023JQ-00005]
ATGGCTAACGGATCAGTAAACAAAGTAATTATTATCGGCAATTTAGGGCGCGATCCTGAAATTCGCTATCTTCCTTCTGG
TGGTGCTATTGCTTATTTAGCTGTGGCCACATCAGAAAAATGGCGTGACAAACAAACAGGTGAAAATCGCGAAAAAACAG
AATGGCATCGTGTCGTTCTGTTTGGAAAACTCGCTGATATCGCCAGTGGCTATTTGTGCAAAGGCTCGCAAGTTTATATC
GAGGGCCAACTACAAACGCGCGAATGGGATGATAACGGCGTTAAACGATACACAACAGAAGTTGTTGTAAGGATTGGAGG
CACAATGCAGATGTTAGGCGGTGCTAGTAAATCAGCAGGATCACAACCGGCACAACAACCGCAACAGTCAAAGCAACAAG
CTCCACAATATCCTGAACCACCAATGGATTTCTCAGACGACATTCCGTTTTAA
ATGGCTAACGGATCAGTAAACAAAGTAATTATTATCGGCAATTTAGGGCGCGATCCTGAAATTCGCTATCTTCCTTCTGG
TGGTGCTATTGCTTATTTAGCTGTGGCCACATCAGAAAAATGGCGTGACAAACAAACAGGTGAAAATCGCGAAAAAACAG
AATGGCATCGTGTCGTTCTGTTTGGAAAACTCGCTGATATCGCCAGTGGCTATTTGTGCAAAGGCTCGCAAGTTTATATC
GAGGGCCAACTACAAACGCGCGAATGGGATGATAACGGCGTTAAACGATACACAACAGAAGTTGTTGTAAGGATTGGAGG
CACAATGCAGATGTTAGGCGGTGCTAGTAAATCAGCAGGATCACAACCGGCACAACAACCGCAACAGTCAAAGCAACAAG
CTCCACAATATCCTGAACCACCAATGGATTTCTCAGACGACATTCCGTTTTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Vibrio cholerae strain A1552 |
58.192 |
100 |
0.687 |
| ssb | Glaesserella parasuis strain SC1401 |
48.066 |
100 |
0.58 |
| ssb | Neisseria meningitidis MC58 |
39.548 |
100 |
0.467 |
| ssb | Neisseria gonorrhoeae MS11 |
39.548 |
100 |
0.467 |