Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | R4T31_RS05255 | Genome accession | NZ_CP137736 |
| Coordinates | 1129580..1130089 (-) | Length | 169 a.a. |
| NCBI ID | WP_017827452.1 | Uniprot ID | - |
| Organism | Proteus mirabilis strain PM32 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1126310..1174760 | 1129580..1130089 | within | 0 |
Gene organization within MGE regions
Location: 1126310..1174760
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| R4T31_RS05225 (R4T31_05225) | - | 1126310..1127311 (-) | 1002 | WP_026164649.1 | tyrosine-type recombinase/integrase | - |
| R4T31_RS05230 (R4T31_05230) | - | 1127268..1127513 (-) | 246 | WP_004246013.1 | excisionase | - |
| R4T31_RS05235 (R4T31_05235) | - | 1127548..1128150 (-) | 603 | Protein_994 | MT-A70 family methyltransferase | - |
| R4T31_RS05240 (R4T31_05240) | - | 1128137..1128364 (-) | 228 | WP_134736555.1 | hypothetical protein | - |
| R4T31_RS05245 (R4T31_05245) | - | 1128511..1128690 (-) | 180 | WP_134736554.1 | hypothetical protein | - |
| R4T31_RS05250 (R4T31_05250) | - | 1128825..1129508 (-) | 684 | WP_134736553.1 | hypothetical protein | - |
| R4T31_RS05255 (R4T31_05255) | ssb | 1129580..1130089 (-) | 510 | WP_017827452.1 | single-stranded DNA-binding protein | Machinery gene |
| R4T31_RS05260 (R4T31_05260) | - | 1130089..1130700 (-) | 612 | WP_017827451.1 | ERF family protein | - |
| R4T31_RS05265 (R4T31_05265) | - | 1130702..1131022 (-) | 321 | WP_017628824.1 | hypothetical protein | - |
| R4T31_RS05270 (R4T31_05270) | - | 1131019..1131171 (-) | 153 | WP_167649897.1 | hypothetical protein | - |
| R4T31_RS05275 (R4T31_05275) | - | 1131171..1131605 (-) | 435 | WP_196573078.1 | SAM-dependent methyltransferase | - |
| R4T31_RS05280 (R4T31_05280) | - | 1131638..1131892 (-) | 255 | WP_134736552.1 | hypothetical protein | - |
| R4T31_RS05285 (R4T31_05285) | - | 1131900..1132055 (-) | 156 | WP_164484711.1 | hypothetical protein | - |
| R4T31_RS05290 (R4T31_05290) | - | 1132144..1132371 (-) | 228 | WP_004247466.1 | hypothetical protein | - |
| R4T31_RS05295 (R4T31_05295) | - | 1132494..1132769 (-) | 276 | WP_134736551.1 | hypothetical protein | - |
| R4T31_RS05300 (R4T31_05300) | - | 1132934..1133119 (+) | 186 | WP_004247469.1 | hypothetical protein | - |
| R4T31_RS05305 (R4T31_05305) | - | 1133116..1133268 (-) | 153 | WP_004247470.1 | hypothetical protein | - |
| R4T31_RS05310 (R4T31_05310) | - | 1133454..1133669 (+) | 216 | WP_135024233.1 | hypothetical protein | - |
| R4T31_RS05315 (R4T31_05315) | - | 1133666..1133881 (-) | 216 | WP_135024230.1 | hypothetical protein | - |
| R4T31_RS05320 (R4T31_05320) | - | 1133890..1134207 (-) | 318 | WP_017827445.1 | hypothetical protein | - |
| R4T31_RS05325 (R4T31_05325) | - | 1134652..1135107 (-) | 456 | WP_060556508.1 | hypothetical protein | - |
| R4T31_RS05330 (R4T31_05330) | - | 1135104..1135682 (-) | 579 | WP_060556509.1 | toxin-antitoxin system HicB family antitoxin | - |
| R4T31_RS05335 (R4T31_05335) | - | 1135679..1135978 (-) | 300 | WP_060556510.1 | hypothetical protein | - |
| R4T31_RS05340 (R4T31_05340) | - | 1136043..1136687 (-) | 645 | WP_163801707.1 | LexA family transcriptional regulator | - |
| R4T31_RS05345 (R4T31_05345) | - | 1136793..1137002 (+) | 210 | WP_004247477.1 | helix-turn-helix transcriptional regulator | - |
| R4T31_RS05350 (R4T31_05350) | - | 1137148..1137495 (+) | 348 | WP_004247478.1 | hypothetical protein | - |
| R4T31_RS05355 (R4T31_05355) | - | 1137591..1137764 (+) | 174 | WP_172409601.1 | hypothetical protein | - |
| R4T31_RS05360 (R4T31_05360) | - | 1137761..1138528 (+) | 768 | WP_060556512.1 | helix-turn-helix domain-containing protein | - |
| R4T31_RS05365 (R4T31_05365) | - | 1138528..1139913 (+) | 1386 | WP_012367618.1 | DnaB-like helicase C-terminal domain-containing protein | - |
| R4T31_RS05370 (R4T31_05370) | - | 1139939..1140388 (+) | 450 | WP_012367619.1 | YbcN family protein | - |
| R4T31_RS05375 (R4T31_05375) | - | 1140467..1140757 (+) | 291 | WP_004245984.1 | DUF1364 domain-containing protein | - |
| R4T31_RS05380 (R4T31_05380) | - | 1140754..1141110 (+) | 357 | WP_004245983.1 | RusA family crossover junction endodeoxyribonuclease | - |
| R4T31_RS05385 (R4T31_05385) | - | 1141110..1141742 (+) | 633 | WP_004247487.1 | bacteriophage antitermination protein Q | - |
| R4T31_RS05390 (R4T31_05390) | - | 1142053..1142574 (+) | 522 | WP_004247148.1 | DUF1440 domain-containing protein | - |
| R4T31_RS05395 (R4T31_05395) | - | 1142733..1143155 (+) | 423 | WP_004247488.1 | hypothetical protein | - |
| R4T31_RS05400 (R4T31_05400) | - | 1143209..1143478 (+) | 270 | WP_004247489.1 | hypothetical protein | - |
| R4T31_RS05405 (R4T31_05405) | - | 1143478..1143948 (+) | 471 | WP_080047831.1 | lysozyme | - |
| R4T31_RS05410 (R4T31_05410) | - | 1143930..1144088 (+) | 159 | WP_012367623.1 | hypothetical protein | - |
| R4T31_RS05415 (R4T31_05415) | - | 1144091..1144552 (+) | 462 | WP_163801711.1 | lysis protein | - |
| R4T31_RS05420 (R4T31_05420) | - | 1144984..1145484 (+) | 501 | WP_233900593.1 | hypothetical protein | - |
| R4T31_RS05425 (R4T31_05425) | - | 1145684..1145842 (+) | 159 | WP_004245978.1 | hypothetical protein | - |
| R4T31_RS05430 (R4T31_05430) | - | 1145876..1146478 (+) | 603 | WP_004247495.1 | hypothetical protein | - |
| R4T31_RS05435 (R4T31_05435) | - | 1146481..1147968 (+) | 1488 | WP_004247496.1 | hypothetical protein | - |
| R4T31_RS05440 (R4T31_05440) | - | 1147968..1149338 (+) | 1371 | WP_004247497.1 | DUF4055 domain-containing protein | - |
| R4T31_RS05445 (R4T31_05445) | - | 1149335..1150456 (+) | 1122 | WP_004247498.1 | hypothetical protein | - |
| R4T31_RS05450 (R4T31_05450) | - | 1150526..1150771 (+) | 246 | WP_004247499.1 | hypothetical protein | - |
| R4T31_RS05455 (R4T31_05455) | - | 1150868..1151629 (+) | 762 | WP_004247500.1 | hypothetical protein | - |
| R4T31_RS05460 (R4T31_05460) | - | 1151643..1152596 (+) | 954 | WP_004247501.1 | major capsid protein | - |
| R4T31_RS05465 (R4T31_05465) | - | 1152650..1152883 (+) | 234 | WP_228766817.1 | Ig-like domain-containing protein | - |
| R4T31_RS05470 (R4T31_05470) | - | 1152923..1153402 (+) | 480 | WP_004245968.1 | DnaT-like ssDNA-binding protein | - |
| R4T31_RS05475 (R4T31_05475) | - | 1153405..1153755 (+) | 351 | WP_004247502.1 | hypothetical protein | - |
| R4T31_RS05480 (R4T31_05480) | - | 1153757..1154338 (+) | 582 | WP_004247503.1 | hypothetical protein | - |
| R4T31_RS05485 (R4T31_05485) | - | 1154335..1154736 (+) | 402 | WP_004247504.1 | phage tail terminator-like protein | - |
| R4T31_RS05490 (R4T31_05490) | - | 1154782..1155438 (+) | 657 | WP_004247505.1 | phage tail protein | - |
| R4T31_RS05495 (R4T31_05495) | - | 1155490..1155795 (+) | 306 | WP_004245960.1 | phage tail assembly chaperone | - |
| R4T31_RS05500 (R4T31_05500) | - | 1155822..1156097 (+) | 276 | WP_004247507.1 | DUF1799 domain-containing protein | - |
| R4T31_RS05505 (R4T31_05505) | - | 1156126..1156332 (-) | 207 | WP_004247508.1 | hypothetical protein | - |
| R4T31_RS05510 (R4T31_05510) | - | 1156485..1156856 (+) | 372 | WP_004247509.1 | hypothetical protein | - |
| R4T31_RS05515 (R4T31_05515) | - | 1156870..1157052 (-) | 183 | WP_004247510.1 | hypothetical protein | - |
| R4T31_RS05520 (R4T31_05520) | - | 1157387..1158388 (+) | 1002 | WP_109880200.1 | hypothetical protein | - |
| R4T31_RS05525 (R4T31_05525) | - | 1158661..1159494 (-) | 834 | WP_046334559.1 | phage antirepressor N-terminal domain-containing protein | - |
| R4T31_RS05530 (R4T31_05530) | - | 1159564..1159725 (-) | 162 | WP_004245955.1 | toxin-antitoxin system HicB family antitoxin | - |
| R4T31_RS05535 (R4T31_05535) | - | 1159839..1160096 (+) | 258 | WP_046334560.1 | Arc family DNA-binding protein | - |
| R4T31_RS05540 (R4T31_05540) | - | 1160093..1160986 (+) | 894 | WP_049257266.1 | DNA translocase FtsK | - |
| R4T31_RS05545 (R4T31_05545) | - | 1161024..1161893 (+) | 870 | WP_046334561.1 | hypothetical protein | - |
| R4T31_RS05550 (R4T31_05550) | - | 1161953..1164892 (+) | 2940 | WP_004247511.1 | phage tail tape measure protein | - |
| R4T31_RS05555 (R4T31_05555) | - | 1164915..1165127 (+) | 213 | WP_004247512.1 | hypothetical protein | - |
| R4T31_RS05560 (R4T31_05560) | - | 1165167..1165457 (+) | 291 | WP_004247513.1 | hypothetical protein | - |
| R4T31_RS05565 (R4T31_05565) | - | 1165477..1165677 (-) | 201 | WP_004247514.1 | hypothetical protein | - |
| R4T31_RS05570 (R4T31_05570) | - | 1165821..1166162 (+) | 342 | WP_004247516.1 | phage tail protein | - |
| R4T31_RS05575 (R4T31_05575) | - | 1166159..1166902 (+) | 744 | WP_004247517.1 | phage minor tail protein L | - |
| R4T31_RS05580 (R4T31_05580) | - | 1166899..1167609 (+) | 711 | WP_004247518.1 | C40 family peptidase | - |
| R4T31_RS05585 (R4T31_05585) | - | 1167606..1168211 (+) | 606 | WP_004247519.1 | tail assembly protein | - |
| R4T31_RS05590 (R4T31_05590) | - | 1168263..1172456 (+) | 4194 | WP_004247520.1 | DUF1983 domain-containing protein | - |
| R4T31_RS05595 (R4T31_05595) | - | 1172462..1172818 (+) | 357 | WP_223307229.1 | hypothetical protein | - |
| R4T31_RS05600 (R4T31_05600) | - | 1172820..1173434 (+) | 615 | WP_004247523.1 | hypothetical protein | - |
| R4T31_RS05605 (R4T31_05605) | - | 1173484..1173744 (+) | 261 | WP_004247524.1 | hypothetical protein | - |
| R4T31_RS05610 (R4T31_05610) | - | 1173884..1174123 (+) | 240 | WP_166470157.1 | hypothetical protein | - |
| R4T31_RS05615 (R4T31_05615) | - | 1174455..1174760 (-) | 306 | WP_004247526.1 | helix-turn-helix domain-containing protein | - |
Sequence
Protein
Download Length: 169 a.a. Molecular weight: 19066.43 Da Isoelectric Point: 6.9903
>NTDB_id=900389 R4T31_RS05255 WP_017827452.1 1129580..1130089(-) (ssb) [Proteus mirabilis strain PM32]
MASKGVNKVLLIGHLGQDPEMRYLPNGDAVTNITLATSDSWKDKQSGETKERVEWHRVVIFGKLAEIAGEYLRKGSQVYI
EGQLQTRKWQDQNGQDRYSTEVVVNINGSMQILGNNNQAGSQKSQPSPHQHGWSLQQSPKRNEPPMDFDDDIPFAPIGLM
YPRHLINII
MASKGVNKVLLIGHLGQDPEMRYLPNGDAVTNITLATSDSWKDKQSGETKERVEWHRVVIFGKLAEIAGEYLRKGSQVYI
EGQLQTRKWQDQNGQDRYSTEVVVNINGSMQILGNNNQAGSQKSQPSPHQHGWSLQQSPKRNEPPMDFDDDIPFAPIGLM
YPRHLINII
Nucleotide
Download Length: 510 bp
>NTDB_id=900389 R4T31_RS05255 WP_017827452.1 1129580..1130089(-) (ssb) [Proteus mirabilis strain PM32]
ATGGCAAGTAAAGGTGTAAACAAAGTCTTATTGATAGGACATCTAGGTCAAGATCCTGAAATGCGTTACCTCCCAAATGG
CGATGCAGTTACTAATATTACATTAGCCACCAGCGATTCATGGAAAGATAAACAATCAGGTGAAACCAAGGAACGTGTCG
AATGGCATAGAGTTGTGATATTTGGAAAGCTCGCCGAAATTGCTGGCGAATATCTGCGTAAAGGTTCACAAGTCTATATC
GAAGGTCAATTACAAACACGTAAATGGCAAGATCAAAATGGACAAGACAGATACAGCACGGAAGTTGTAGTGAATATTAA
TGGCTCAATGCAAATTTTAGGTAACAACAATCAGGCTGGTAGCCAGAAATCACAACCATCACCTCATCAACACGGATGGA
GCCTTCAACAATCTCCTAAGCGTAATGAACCTCCAATGGATTTTGATGATGATATTCCTTTTGCGCCGATTGGGCTTATG
TATCCACGACATTTGATTAATATAATTTAG
ATGGCAAGTAAAGGTGTAAACAAAGTCTTATTGATAGGACATCTAGGTCAAGATCCTGAAATGCGTTACCTCCCAAATGG
CGATGCAGTTACTAATATTACATTAGCCACCAGCGATTCATGGAAAGATAAACAATCAGGTGAAACCAAGGAACGTGTCG
AATGGCATAGAGTTGTGATATTTGGAAAGCTCGCCGAAATTGCTGGCGAATATCTGCGTAAAGGTTCACAAGTCTATATC
GAAGGTCAATTACAAACACGTAAATGGCAAGATCAAAATGGACAAGACAGATACAGCACGGAAGTTGTAGTGAATATTAA
TGGCTCAATGCAAATTTTAGGTAACAACAATCAGGCTGGTAGCCAGAAATCACAACCATCACCTCATCAACACGGATGGA
GCCTTCAACAATCTCCTAAGCGTAATGAACCTCCAATGGATTTTGATGATGATATTCCTTTTGCGCCGATTGGGCTTATG
TATCCACGACATTTGATTAATATAATTTAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Vibrio cholerae strain A1552 |
63.277 |
100 |
0.663 |
| ssb | Glaesserella parasuis strain SC1401 |
47.753 |
100 |
0.503 |
| ssb | Neisseria gonorrhoeae MS11 |
42.045 |
100 |
0.438 |
| ssb | Neisseria meningitidis MC58 |
42.045 |
100 |
0.438 |