Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   R6I06_RS13280 Genome accession   NZ_CP137711
Coordinates   2527927..2528310 (-) Length   127 a.a.
NCBI ID   WP_003230168.1    Uniprot ID   -
Organism   Bacillus subtilis isolate FELIX_MS886     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2522927..2533310
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  R6I06_RS13240 (R6I06_13240) sinI 2523864..2524037 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  R6I06_RS13245 (R6I06_13245) sinR 2524071..2524406 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  R6I06_RS13250 (R6I06_13250) tasA 2524496..2525281 (-) 786 WP_004398632.1 biofilm matrix protein TasA -
  R6I06_RS13255 (R6I06_13255) sipW 2525345..2525917 (-) 573 WP_003246088.1 signal peptidase I SipW -
  R6I06_RS13260 (R6I06_13260) tapA 2525901..2526662 (-) 762 WP_004399106.1 amyloid fiber anchoring/assembly protein TapA -
  R6I06_RS13265 (R6I06_13265) yqzG 2526934..2527260 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  R6I06_RS13270 (R6I06_13270) spoIITA 2527302..2527481 (-) 180 WP_003230176.1 YqzE family protein -
  R6I06_RS13275 (R6I06_13275) comGG 2527552..2527926 (-) 375 WP_003230170.1 ComG operon protein ComGG Machinery gene
  R6I06_RS13280 (R6I06_13280) comGF 2527927..2528310 (-) 384 WP_003230168.1 ComG operon protein ComGF Machinery gene
  R6I06_RS13285 (R6I06_13285) comGE 2528336..2528683 (-) 348 WP_003230165.1 ComG operon protein 5 Machinery gene
  R6I06_RS13290 (R6I06_13290) comGD 2528667..2529098 (-) 432 WP_004398628.1 comG operon protein ComGD Machinery gene
  R6I06_RS13295 (R6I06_13295) comGC 2529088..2529384 (-) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  R6I06_RS13300 (R6I06_13300) comGB 2529398..2530435 (-) 1038 WP_009967727.1 comG operon protein ComGB Machinery gene
  R6I06_RS13305 (R6I06_13305) comGA 2530422..2531492 (-) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  R6I06_RS13310 (R6I06_13310) corA 2531904..2532857 (-) 954 WP_032723504.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14281.37 Da        Isoelectric Point: 5.8929

>NTDB_id=900125 R6I06_RS13280 WP_003230168.1 2527927..2528310(-) (comGF) [Bacillus subtilis isolate FELIX_MS886]
MLISGSLAAIIHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLICTNLSGQDIRFDIYHSMIRKRVDG
KGHVPILDHITAMKADIENGVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=900125 R6I06_RS13280 WP_003230168.1 2527927..2528310(-) (comGF) [Bacillus subtilis isolate FELIX_MS886]
TTGCTCATATCAGGATCGTTAGCTGCGATTATCCATCTGTTTTTGTCTCGACAGCAGGAACATGACGGTTTCACACAGCA
GGAATGGATGATTTCGATAGAACAGATGATGAATGAATGCAAGGAATCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGACAAGACATCCGTTTTGACATTTATCATTCAATGATAAGAAAAAGAGTGGATGGC
AAAGGGCATGTTCCGATTTTAGATCATATTACTGCCATGAAAGCTGATATTGAAAATGGTGTTGTTTTGCTGAAAATTGA
GAGTGAAGACCAAAAAGTGTATCAAACTGCTTTTCCAGTCTATTCGTATTTAGGAGGGGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

100

100

1