Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   R6I06_RS13240 Genome accession   NZ_CP137711
Coordinates   2523864..2524037 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus subtilis isolate FELIX_MS886     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2518864..2529037
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  R6I06_RS13225 (R6I06_13225) gcvT 2519663..2520751 (-) 1089 WP_004398598.1 glycine cleavage system aminomethyltransferase GcvT -
  R6I06_RS13230 (R6I06_13230) hepAA 2521193..2522866 (+) 1674 WP_004398544.1 DEAD/DEAH box helicase -
  R6I06_RS13235 (R6I06_13235) yqhG 2522887..2523681 (+) 795 WP_003230200.1 YqhG family protein -
  R6I06_RS13240 (R6I06_13240) sinI 2523864..2524037 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  R6I06_RS13245 (R6I06_13245) sinR 2524071..2524406 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  R6I06_RS13250 (R6I06_13250) tasA 2524496..2525281 (-) 786 WP_004398632.1 biofilm matrix protein TasA -
  R6I06_RS13255 (R6I06_13255) sipW 2525345..2525917 (-) 573 WP_003246088.1 signal peptidase I SipW -
  R6I06_RS13260 (R6I06_13260) tapA 2525901..2526662 (-) 762 WP_004399106.1 amyloid fiber anchoring/assembly protein TapA -
  R6I06_RS13265 (R6I06_13265) yqzG 2526934..2527260 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  R6I06_RS13270 (R6I06_13270) spoIITA 2527302..2527481 (-) 180 WP_003230176.1 YqzE family protein -
  R6I06_RS13275 (R6I06_13275) comGG 2527552..2527926 (-) 375 WP_003230170.1 ComG operon protein ComGG Machinery gene
  R6I06_RS13280 (R6I06_13280) comGF 2527927..2528310 (-) 384 WP_003230168.1 ComG operon protein ComGF Machinery gene
  R6I06_RS13285 (R6I06_13285) comGE 2528336..2528683 (-) 348 WP_003230165.1 ComG operon protein 5 Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=900122 R6I06_RS13240 WP_003230187.1 2523864..2524037(+) (sinI) [Bacillus subtilis isolate FELIX_MS886]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=900122 R6I06_RS13240 WP_003230187.1 2523864..2524037(+) (sinI) [Bacillus subtilis isolate FELIX_MS886]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-36)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1