Detailed information    

insolico Bioinformatically predicted

Overview


Name   ideA   Type   Regulator
Locus tag   LDO90_RS04035 Genome accession   NZ_AP025147
Coordinates   845657..846340 (-) Length   227 a.a.
NCBI ID   WP_224067540.1    Uniprot ID   -
Organism   Vibrio penaeicida strain IFO 15641     
Function   repress natural transformation (predicted from homology)   
Competence regulation

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 774531..860773 845657..846340 within 0


Gene organization within MGE regions


Location: 774531..860773
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  LDO90_RS03730 rimP 774774..775229 (+) 456 WP_126607605.1 ribosome maturation factor RimP -
  LDO90_RS03735 nusA 775248..776735 (+) 1488 WP_104401421.1 transcription termination factor NusA -
  LDO90_RS03740 infB 776757..779462 (+) 2706 WP_126607604.1 translation initiation factor IF-2 -
  LDO90_RS03745 rbfA 779561..779956 (+) 396 WP_101113242.1 30S ribosome-binding factor RbfA -
  LDO90_RS03750 truB 779956..780909 (+) 954 WP_126607603.1 tRNA pseudouridine(55) synthase TruB -
  LDO90_RS03755 rpsO 781105..781374 (+) 270 WP_101113239.1 30S ribosomal protein S15 -
  LDO90_RS03760 pnp 781645..783768 (+) 2124 WP_101113238.1 polyribonucleotide nucleotidyltransferase -
  LDO90_RS03765 nlpI 783963..784841 (+) 879 WP_126607610.1 lipoprotein NlpI -
  LDO90_RS03770 - 784904..785782 (-) 879 WP_126607602.1 U32 family peptidase -
  LDO90_RS03775 - 785799..786812 (-) 1014 WP_224067527.1 peptidase U32 family protein -
  LDO90_RS03780 - 786956..788992 (-) 2037 WP_126607600.1 bifunctional diguanylate cyclase/phosphodiesterase -
  LDO90_RS03785 - 789188..789715 (+) 528 WP_126607599.1 SCP2 domain-containing protein -
  LDO90_RS03790 - 789699..790202 (+) 504 WP_126607598.1 GNAT family N-acetyltransferase -
  LDO90_RS03795 - 790281..791399 (-) 1119 WP_126607597.1 class II histone deacetylase -
  LDO90_RS03800 - 791392..792591 (-) 1200 WP_126607596.1 MFS transporter -
  LDO90_RS03805 - 792705..793682 (-) 978 WP_126607595.1 LuxR C-terminal-related transcriptional regulator -
  LDO90_RS03810 - 793991..794293 (+) 303 WP_101113229.1 hypothetical protein -
  LDO90_RS03815 - 794452..794844 (+) 393 WP_126609489.1 DNA polymerase III subunit psi -
  LDO90_RS03820 rimI 794837..795283 (+) 447 WP_126609490.1 ribosomal protein S18-alanine N-acetyltransferase -
  LDO90_RS03825 - 795365..797800 (-) 2436 WP_126609491.1 EAL domain-containing protein -
  LDO90_RS03830 - 797853..798560 (-) 708 WP_126609492.1 ABC transporter substrate-binding protein -
  LDO90_RS03835 - 798991..799215 (-) 225 WP_126608357.1 hypothetical protein -
  LDO90_RS03840 - 799338..799415 (+) 78 Protein_724 peptide chain release factor 3 -
  LDO90_RS03845 - 800095..800931 (+) 837 WP_224067529.1 type IV toxin-antitoxin system AbiEi family antitoxin -
  LDO90_RS03850 - 800940..801854 (+) 915 WP_224067530.1 nucleotidyl transferase AbiEii/AbiGii toxin family protein -
  LDO90_RS03855 - 801976..802170 (+) 195 WP_000127614.1 AlpA family transcriptional regulator -
  LDO90_RS03860 - 802182..803423 (-) 1242 WP_224067531.1 integrase family protein -
  LDO90_RS03865 - 803425..803694 (-) 270 WP_094697232.1 hypothetical protein -
  LDO90_RS03870 - 803697..804671 (-) 975 WP_094697233.1 ParM/StbA family protein -
  LDO90_RS03875 mobI 805136..805579 (+) 444 WP_094697235.1 conjugative transfer protein MobI(A/C) -
  LDO90_RS03880 umuC 805590..806858 (-) 1269 WP_224067532.1 translesion error-prone DNA polymerase V subunit UmuC -
  LDO90_RS03885 umuD 806866..807315 (-) 450 WP_007105028.1 translesion error-prone DNA polymerase V autoproteolytic subunit -
  LDO90_RS03890 - 807972..808892 (+) 921 WP_224067533.1 3'-5' exonuclease -
  LDO90_RS03895 - 808965..809264 (+) 300 WP_065767345.1 hypothetical protein -
  LDO90_RS03900 - 809582..810517 (+) 936 WP_193284088.1 WYL domain-containing protein -
  LDO90_RS03905 - 810555..813887 (+) 3333 WP_224067534.1 helicase-related protein -
  LDO90_RS03910 - 813891..814577 (+) 687 WP_024024112.1 DUF4391 domain-containing protein -
  LDO90_RS03915 - 814660..816606 (+) 1947 WP_023266697.1 site-specific DNA-methyltransferase -
  LDO90_RS03920 - 816616..819693 (+) 3078 WP_065767339.1 type III restriction-modification system endonuclease -
  LDO90_RS03925 - 819767..820621 (+) 855 WP_024024115.1 restriction endonuclease -
  LDO90_RS03930 mobH 820716..822866 (+) 2151 WP_224067535.1 MobH family relaxase -
  LDO90_RS03935 traD 822915..824735 (+) 1821 WP_065767335.1 conjugative transfer system coupling protein TraD -
  LDO90_RS03940 - 824745..825305 (+) 561 WP_065767333.1 conjugative transfer protein -
  LDO90_RS03945 - 825292..825927 (+) 636 WP_000033756.1 DUF4400 domain-containing protein -
  LDO90_RS03950 - 826041..826637 (+) 597 WP_129980172.1 hypothetical protein -
  LDO90_RS03955 - 826630..827736 (+) 1107 WP_031500457.1 ImmA/IrrE family metallo-endopeptidase -
  LDO90_RS03960 traL 827873..828154 (+) 282 WP_000433891.1 type IV conjugative transfer system protein TraL -
  LDO90_RS03965 - 828151..828777 (+) 627 WP_000667170.1 TraE/TraK family type IV conjugative transfer system protein -
  LDO90_RS03970 - 828761..829657 (+) 897 WP_224067580.1 type-F conjugative transfer system secretin TraK -
  LDO90_RS03975 - 829660..830949 (+) 1290 WP_169650375.1 TraB/VirB10 family protein -
  LDO90_RS03980 traV 831024..831596 (+) 573 WP_224067536.1 type IV conjugative transfer system lipoprotein TraV -
  LDO90_RS03985 traA 831593..831967 (+) 375 WP_023266685.1 TraA family conjugative transfer protein -
  LDO90_RS03990 - 832043..832771 (+) 729 WP_065767329.1 hypothetical protein -
  LDO90_RS03995 - 832959..833651 (+) 693 WP_065767327.1 DsbC family protein -
  LDO90_RS04000 traC 833651..836050 (+) 2400 WP_224067537.1 type IV secretion system protein TraC -
  LDO90_RS04005 - 836043..836390 (+) 348 WP_024008830.1 hypothetical protein -
  LDO90_RS04010 - 836374..836886 (+) 513 WP_180949878.1 S26 family signal peptidase -
  LDO90_RS04015 - 836897..838021 (+) 1125 WP_224067581.1 TrbC family F-type conjugative pilus assembly protein -
  LDO90_RS04020 - 838005..839033 (+) 1029 WP_224067538.1 TraU family protein -
  LDO90_RS04025 traN 839036..842728 (+) 3693 WP_224067539.1 conjugal transfer protein TraN -
  LDO90_RS29180 - 842819..844384 (-) 1566 WP_001918292.1 hypothetical protein -
  LDO90_RS29185 - 844529..845485 (-) 957 Protein_763 AAA family ATPase -
  LDO90_RS04035 ideA 845657..846340 (-) 684 WP_224067540.1 endonuclease Regulator
  LDO90_RS04040 - 846449..847051 (-) 603 WP_224067541.1 hypothetical protein -
  LDO90_RS04045 - 847419..847745 (+) 327 WP_156734069.1 plasmid-related protein -
  LDO90_RS04050 - 847761..848180 (+) 420 WP_224067542.1 single-stranded DNA-binding protein -
  LDO90_RS04055 bet 848260..849078 (+) 819 WP_000414662.1 phage recombination protein Bet -
  LDO90_RS04060 - 849161..849304 (+) 144 WP_000167275.1 hypothetical protein -
  LDO90_RS04065 - 849365..850381 (+) 1017 WP_067206279.1 YqaJ viral recombinase family protein -
  LDO90_RS04070 - 850591..851550 (+) 960 WP_000139695.1 AAA family ATPase -
  LDO90_RS04075 - 851550..852317 (+) 768 WP_224067543.1 hypothetical protein -
  LDO90_RS04080 - 852416..853369 (+) 954 WP_224067544.1 DUF3150 domain-containing protein -
  LDO90_RS04085 - 853431..853871 (+) 441 WP_224067545.1 hypothetical protein -
  LDO90_RS04090 - 853941..855596 (+) 1656 WP_224067546.1 VWA domain-containing protein -
  LDO90_RS04095 radC 855680..856177 (+) 498 WP_000797298.1 DNA repair protein RadC -
  LDO90_RS04100 - 856177..856518 (+) 342 WP_224067547.1 plasmid-related protein -
  LDO90_RS04105 - 856610..857683 (+) 1074 WP_224067548.1 primase-helicase zinc-binding domain-containing protein -
  LDO90_RS04110 - 857773..858471 (+) 699 WP_224067549.1 hypothetical protein -
  LDO90_RS04115 rsgA 858562..859599 (-) 1038 WP_193021840.1 ribosome small subunit-dependent GTPase A -
  LDO90_RS04120 - 859609..860151 (-) 543 WP_193021841.1 GNAT family N-acetyltransferase -

Sequence


Protein


Download         Length: 227 a.a.        Molecular weight: 26391.52 Da        Isoelectric Point: 7.5402

>NTDB_id=89986 LDO90_RS04035 WP_224067540.1 845657..846340(-) (ideA) [Vibrio penaeicida strain IFO 15641]
MNRTNFLVTFLIALFAIPAFAEHPTSFSQAKRFAREIYQDNQSTFYCGCSYNNDGAIDAASCGYEPRKQPKRGERLEWEH
VASAWEIGHQRQCWQNGGRRNCEKNDPEFSKMVSDLHNLVPSVGELNGDRSNFRFGMIPNEPRAYGLCDFEVDFKDRRAE
PPANRQGDIARIYFYMRDQYGLRLSRQQTQLFEAWSRMDPVDEWEKLRDLRIRGIQGKSNCYVSGSC

Nucleotide


Download         Length: 684 bp        

>NTDB_id=89986 LDO90_RS04035 WP_224067540.1 845657..846340(-) (ideA) [Vibrio penaeicida strain IFO 15641]
ATGAATAGAACTAATTTTCTCGTTACCTTCTTAATAGCGTTGTTCGCTATCCCTGCATTTGCAGAACACCCAACATCGTT
CAGCCAGGCAAAACGATTTGCCCGAGAAATTTACCAAGACAACCAGAGTACGTTTTACTGTGGATGTAGCTATAACAATG
ATGGTGCGATTGATGCTGCATCTTGCGGATATGAACCAAGGAAGCAACCGAAACGAGGAGAACGCTTAGAGTGGGAGCAC
GTTGCCTCAGCTTGGGAAATTGGCCATCAACGCCAATGCTGGCAAAATGGTGGTCGTCGGAACTGTGAAAAGAATGATCC
TGAGTTTTCTAAAATGGTGTCGGATCTCCATAACCTTGTACCATCTGTAGGAGAACTCAATGGGGATAGATCAAATTTTC
GATTTGGCATGATTCCGAATGAACCAAGAGCCTATGGTCTATGTGATTTCGAAGTTGATTTCAAAGACCGTCGAGCAGAA
CCACCAGCTAACCGTCAGGGTGATATTGCTAGAATTTATTTCTACATGCGAGATCAATACGGCCTAAGACTAAGCAGACA
ACAAACTCAGCTATTTGAAGCTTGGTCAAGAATGGACCCTGTTGATGAGTGGGAAAAATTACGTGATTTGAGGATTAGAG
GCATTCAAGGTAAGTCTAATTGCTATGTATCAGGCAGCTGCTAG

Domains


Predicted by InterproScan.

(41-224)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ideA Vibrio cholerae O1 str. 2010EL-1786

98.678

100

0.987

  dns Vibrio parahaemolyticus RIMD 2210633

51.965

100

0.524

  dns Aliivibrio fischeri ES114

51.739

100

0.524

  dns Vibrio cholerae strain A1552

50.667

99.119

0.502

  dns Campylobacter jejuni RM1221

38.393

98.678

0.379


Multiple sequence alignment