Detailed information    

insolico Bioinformatically predicted

Overview

Name   ssb   Type   Machinery gene
Locus tag   R3372_RS13175 Genome accession   NZ_CP137335
Coordinates   2859598..2860137 (+) Length   179 a.a.
NCBI ID   WP_317889092.1    Uniprot ID   -
Organism   Proteus mirabilis strain PM16     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 2824689..2866364 2859598..2860137 within 0


Gene organization within MGE regions


Location: 2824689..2866364
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  R3372_RS12905 (R3372_12905) - 2824689..2824919 (+) 231 WP_317889064.1 DNA polymerase III subunit theta -
  R3372_RS12910 (R3372_12910) - 2824920..2826794 (-) 1875 WP_317889065.1 phage head-binding domain-containing protein -
  R3372_RS12915 (R3372_12915) - 2826903..2827154 (+) 252 WP_152134463.1 Arc family DNA-binding protein -
  R3372_RS12920 (R3372_12920) - 2827172..2827537 (+) 366 WP_159108767.1 hypothetical protein -
  R3372_RS12925 (R3372_12925) - 2827545..2828024 (+) 480 WP_317889066.1 hypothetical protein -
  R3372_RS12930 (R3372_12930) - 2828047..2829990 (-) 1944 WP_317889067.1 lytic transglycosylase domain-containing protein -
  R3372_RS12935 (R3372_12935) - 2829975..2831543 (-) 1569 WP_317889068.1 phage DNA ejection protein -
  R3372_RS12940 (R3372_12940) - 2831553..2832227 (-) 675 WP_317889069.1 DNA transfer protein -
  R3372_RS12945 (R3372_12945) - 2832221..2832682 (-) 462 WP_317889070.1 DUF2824 family protein -
  R3372_RS12950 (R3372_12950) - 2832682..2833401 (-) 720 WP_317889071.1 phage tail protein -
  R3372_RS12955 (R3372_12955) - 2833401..2835182 (-) 1782 WP_317889072.1 packaged DNA stabilization protein -
  R3372_RS12960 (R3372_12960) - 2835154..2835651 (-) 498 WP_317889073.1 packaged DNA stabilization gp4 family protein -
  R3372_RS12965 (R3372_12965) - 2835629..2835838 (-) 210 WP_311751265.1 hypothetical protein -
  R3372_RS12970 (R3372_12970) - 2835819..2836034 (-) 216 WP_311751264.1 hypothetical protein -
  R3372_RS12975 (R3372_12975) - 2836086..2837369 (-) 1284 WP_317889074.1 P22 phage major capsid protein family protein -
  R3372_RS12980 (R3372_12980) - 2837369..2838283 (-) 915 WP_317889075.1 scaffolding protein -
  R3372_RS12985 (R3372_12985) - 2838298..2840388 (-) 2091 WP_317889076.1 portal protein -
  R3372_RS12990 (R3372_12990) - 2840391..2841710 (-) 1320 WP_232062975.1 terminase large subunit -
  R3372_RS12995 (R3372_12995) - 2841862..2842353 (-) 492 WP_317889077.1 DNA-packaging protein -
  R3372_RS13000 (R3372_13000) - 2842408..2842635 (-) 228 WP_317889078.1 DUF2560 family protein -
  R3372_RS13005 (R3372_13005) - 2842946..2843137 (-) 192 WP_317889079.1 crAss001_48 related protein -
  R3372_RS13010 (R3372_13010) - 2843366..2843773 (-) 408 WP_262381497.1 lysis protein -
  R3372_RS13015 (R3372_13015) - 2843815..2844207 (-) 393 WP_149127662.1 M15 family metallopeptidase -
  R3372_RS13020 (R3372_13020) - 2844200..2844517 (-) 318 WP_109391054.1 phage holin, lambda family -
  R3372_RS13025 (R3372_13025) - 2844998..2845492 (-) 495 WP_262381271.1 DUF1133 family protein -
  R3372_RS13030 (R3372_13030) - 2845609..2845800 (-) 192 WP_149127664.1 hypothetical protein -
  R3372_RS13035 (R3372_13035) - 2845800..2846420 (-) 621 WP_149127665.1 recombination protein NinG -
  R3372_RS13040 (R3372_13040) - 2846424..2846582 (-) 159 WP_162557224.1 hypothetical protein -
  R3372_RS13045 (R3372_13045) - 2846694..2846987 (-) 294 WP_149127666.1 hypothetical protein -
  R3372_RS13050 (R3372_13050) - 2846984..2847424 (-) 441 WP_149127667.1 hypothetical protein -
  R3372_RS13055 (R3372_13055) - 2847427..2847549 (-) 123 WP_259694431.1 hypothetical protein -
  R3372_RS13060 (R3372_13060) - 2847546..2847989 (-) 444 WP_317889080.1 YbcN family protein -
  R3372_RS13065 (R3372_13065) - 2848147..2848365 (-) 219 WP_317889081.1 hypothetical protein -
  R3372_RS13070 (R3372_13070) - 2848358..2848612 (-) 255 WP_317889082.1 Lar family restriction alleviation protein -
  R3372_RS13075 (R3372_13075) - 2848823..2849047 (-) 225 WP_317889083.1 DUF551 domain-containing protein -
  R3372_RS13080 (R3372_13080) - 2849061..2849396 (-) 336 WP_211849436.1 hypothetical protein -
  R3372_RS13085 (R3372_13085) - 2849416..2850792 (-) 1377 WP_317889084.1 replicative DNA helicase -
  R3372_RS13090 (R3372_13090) - 2850792..2851880 (-) 1089 WP_317889085.1 replication protein -
  R3372_RS13095 (R3372_13095) - 2851873..2852049 (-) 177 WP_164484703.1 hypothetical protein -
  R3372_RS13100 (R3372_13100) - 2852166..2852492 (-) 327 WP_049220837.1 CII family transcriptional regulator -
  R3372_RS13105 (R3372_13105) - 2852627..2852812 (-) 186 WP_036895075.1 Cro/CI family transcriptional regulator -
  R3372_RS13110 (R3372_13110) - 2852908..2853618 (+) 711 WP_317889086.1 LexA family transcriptional regulator -
  R3372_RS13115 (R3372_13115) - 2853627..2853968 (+) 342 WP_004245991.1 DUF3024 domain-containing protein -
  R3372_RS13120 (R3372_13120) - 2854062..2854967 (+) 906 WP_317889087.1 hypothetical protein -
  R3372_RS13125 (R3372_13125) - 2855343..2855612 (+) 270 WP_036970054.1 hypothetical protein -
  R3372_RS13130 (R3372_13130) - 2855627..2855863 (+) 237 WP_263068801.1 hypothetical protein -
  R3372_RS13135 (R3372_13135) - 2855835..2856116 (-) 282 WP_317889088.1 DUF2622 domain-containing protein -
  R3372_RS13140 (R3372_13140) - 2856318..2856557 (+) 240 WP_001966870.1 hypothetical protein -
  R3372_RS13145 (R3372_13145) - 2856592..2856837 (+) 246 WP_126656347.1 hypothetical protein -
  R3372_RS13150 (R3372_13150) - 2857060..2857314 (+) 255 WP_317889089.1 hypothetical protein -
  R3372_RS13155 (R3372_13155) - 2857347..2857784 (+) 438 WP_196562798.1 SAM-dependent methyltransferase -
  R3372_RS13160 (R3372_13160) - 2857781..2858032 (+) 252 WP_317889090.1 hypothetical protein -
  R3372_RS13165 (R3372_13165) - 2858029..2858913 (+) 885 WP_317889091.1 RecT family recombinase -
  R3372_RS13170 (R3372_13170) - 2858910..2859608 (+) 699 WP_406948053.1 lambda exonuclease family protein -
  R3372_RS13175 (R3372_13175) ssb 2859598..2860137 (+) 540 WP_317889092.1 single-stranded DNA-binding protein Machinery gene
  R3372_RS13180 (R3372_13180) - 2860153..2860431 (+) 279 WP_151251104.1 hypothetical protein -
  R3372_RS13185 (R3372_13185) - 2860478..2860651 (+) 174 WP_239456936.1 hypothetical protein -
  R3372_RS13190 (R3372_13190) - 2860854..2861207 (+) 354 WP_317889093.1 hypothetical protein -
  R3372_RS13195 (R3372_13195) - 2861217..2861453 (+) 237 WP_317889094.1 hypothetical protein -
  R3372_RS13200 (R3372_13200) - 2861619..2861831 (+) 213 WP_063693248.1 hypothetical protein -
  R3372_RS13205 (R3372_13205) - 2861824..2862165 (+) 342 WP_317889095.1 phage protein NinX family protein -
  R3372_RS13210 (R3372_13210) - 2862152..2862754 (+) 603 WP_317889096.1 MT-A70 family methyltransferase -
  R3372_RS13220 (R3372_13220) - 2863190..2864347 (+) 1158 WP_317889097.1 site-specific integrase -
  R3372_RS13230 (R3372_13230) folD 2864636..2865508 (+) 873 WP_017827221.1 bifunctional methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase FolD -
  R3372_RS13235 (R3372_13235) ybcJ 2865512..2865724 (+) 213 WP_004244244.1 ribosome-associated protein YbcJ -

Sequence

Protein


Download         Length: 179 a.a.        Molecular weight: 19766.14 Da        Isoelectric Point: 7.2415

>NTDB_id=897494 R3372_RS13175 WP_317889092.1 2859598..2860137(+) (ssb) [Proteus mirabilis strain PM16]
MASKGVNKCILIGHLGQDPEIRYMPSGGAVANLTLATSESWRDKQTGEMKEKTEWHRVCIFGKLAEIAGEYLRKGSQVYI
EGQLQTRKWQDQSGQDRYSTEVVVNIGGTMQMLGGNGGNQVGSQKPQQNQGWGQPQQPQAPKQASSNQTPQSEPPQDWDD
SIPFAPIGLPYPRHAIYVI

Nucleotide


Download         Length: 540 bp        

>NTDB_id=897494 R3372_RS13175 WP_317889092.1 2859598..2860137(+) (ssb) [Proteus mirabilis strain PM16]
ATGGCAAGTAAAGGCGTGAATAAATGTATTCTCATTGGTCACTTGGGGCAGGATCCAGAAATCCGCTATATGCCATCAGG
TGGCGCAGTAGCAAATCTCACACTAGCCACATCGGAATCGTGGCGTGATAAGCAGACTGGTGAAATGAAGGAGAAAACTG
AGTGGCATCGAGTGTGCATCTTCGGCAAATTAGCAGAAATTGCAGGTGAATATCTGCGTAAAGGTTCACAAGTTTATATT
GAAGGTCAATTACAAACACGTAAATGGCAAGATCAAAGTGGTCAAGATCGCTACAGCACTGAAGTTGTGGTGAATATCGG
TGGCACAATGCAGATGTTAGGTGGTAACGGTGGTAATCAGGTAGGAAGCCAGAAACCACAGCAGAATCAAGGATGGGGCC
AACCACAGCAACCGCAAGCACCAAAACAAGCATCGAGTAATCAAACACCACAAAGTGAGCCACCTCAAGATTGGGATGAT
TCTATACCTTTCGCTCCTATCGGACTCCCCTACCCACGCCACGCTATTTATGTGATTTAA

Domains

Predicted by InterproScan.

Single-strand binding protein family (SSB)

(6-112)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Vibrio cholerae strain A1552

69.492

98.883

0.687
  ssb Glaesserella parasuis strain SC1401

51.381

100

0.52
  ssb Neisseria meningitidis MC58

43.75

98.324

0.43
  ssb Neisseria gonorrhoeae MS11

43.182

98.324

0.425